KEGG   Macaca mulatta (rhesus monkey): 702837
Entry
702837            CDS       T01028                                 

Gene name
MAPK7
Definition
(RefSeq) mitogen-activated protein kinase 7 isoform X4
  KO
K04464  mitogen-activated protein kinase 7 [EC:2.7.11.24]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04010  MAPK signaling pathway
mcc04540  Gap junction
mcc04657  IL-17 signaling pathway
mcc04722  Neurotrophin signaling pathway
mcc04912  GnRH signaling pathway
mcc04921  Oxytocin signaling pathway
mcc05206  MicroRNAs in cancer
mcc05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    702837 (MAPK7)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    702837 (MAPK7)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    702837 (MAPK7)
  09152 Endocrine system
   04912 GnRH signaling pathway
    702837 (MAPK7)
   04921 Oxytocin signaling pathway
    702837 (MAPK7)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    702837 (MAPK7)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    702837 (MAPK7)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    702837 (MAPK7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcc01001]
    702837 (MAPK7)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     702837 (MAPK7)
Protein kinases [BR:mcc01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   702837 (MAPK7)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo Kinase-like APH Rrn6
Other DBs
NCBI-GeneID: 702837
NCBI-ProteinID: XP_001099826
Ensembl: ENSMMUG00000008536
LinkDB
Position
16
AA seq 816 aa
MAEPLKEEDGEDGSAEPPGPVKAEPAHTAASVAAKNLALLKARSFDVTFDVGDEYEIIET
IGNGAYGVVSSARRRLTGQQVAIKKIPNAFDVVTNAKRTLRELKILKHFKHDNIIAIKDI
LRPTVPYGEFKSVYVVLDLMESDLHQIIHSSQPLTLEHVRYFLYQLLRGLKYMHSAQVIH
RDLKPSNLLVNENCELKIGDFGMARGLCTSPAEHQYFMTEYVATRWYRAPELMLSLHEYT
QAIDLWSVGCIFGEMLARRQLFPGKNYVHQLQLIMMVLGTPSPAVIQAVGAERVRAYIQS
LPPRQPVPWETVYPGADRQALSLLGRMLRFEPSARISAAAALRHPFLAKYHDPDDEPDCA
PPFDFAFDREALTRERIKEAIVAEIEDFHARREGIRQQIRFQPSLQPVASEPGCPDVEMP
SPWAPSGDCAMESPPPAPPPCPGPAPDTIDLTLQPPPPASEPAPPKKEGAISDNTKAALK
AALLKSLRSRLRDGPSAPLEASEPRKPVTAQERQREREEKRRRRQERAKEREKRRQERER
KERGAGASGGPSTDPLAGLVLSDNDRSLLERWTRMARPPAPAPTSVPAPAPVPTPTPAQP
ASPPPGPVAQPTGPQPQPQPVGSTSGPVPQPACPPPGPAAHPTGPPRPIPVPAPPQIATS
TSLLAPQSLVPPPGLPGSNTPGVLPYFPPGLPPTDAGGAPQSSMSESPDVNLVTQQLSKS
QVEDPLPPVFSGTPKGSGAGYGVGFDLEEFLNQSFDMGVADGPQDGQSDSASLSASLLAD
WLEGHGMNPADIESLQREIQMDSPMLLADLPDLQDP
NT seq 2451 nt   +upstreamnt  +downstreamnt
atggccgagcccctgaaggaggaagacggcgaggacggctctgcggaaccccccgggccc
gtgaaggccgaacccgcccacaccgctgcctctgtagcggccaagaacctggccctgctt
aaagcccgctccttcgatgtgacctttgacgtgggcgacgagtacgagatcatcgagacc
ataggcaacggggcctacggagtggtgtcctccgcccgccgccgcctcaccggccagcag
gtggccatcaagaagatccctaatgcttttgatgtggtgaccaatgccaagcgaaccctc
agggagctgaagatcctcaagcactttaagcacgacaacatcatcgccatcaaggacatc
ctgaggcccactgtgccctatggcgaattcaaatctgtctacgtggtcctggacctgatg
gaaagtgacctgcaccagatcatccactcctcacagcccctcacactggaacacgtgcgc
tacttcctgtaccaactgctgcggggcctgaagtacatgcactcggctcaggtcatccac
cgtgacctcaagccctccaacctattggtgaatgagaactgtgagctcaagattggtgac
tttggtatggctcgtggcctgtgcacctcgcccgctgaacatcagtacttcatgaccgag
tatgtggccacgcgctggtaccgtgcccctgagctcatgctctctttgcatgagtataca
caggctattgacctttggtctgtgggctgcatctttggtgagatgctggcccggcgccag
ctcttcccgggcaaaaactatgtacaccagctgcagctcatcatgatggtgctgggtacc
ccatcaccagccgtgattcaggctgtgggggctgagagggtgcgggcctatatccagagc
ttgccaccacgccagcctgtgccctgggagacagtgtacccaggtgccgaccgtcaggcc
ctatcactcctgggtcgcatgctgcgttttgagcccagcgcccgcatctcagcagctgct
gcccttcgccaccctttcctggccaagtaccatgatcctgatgatgagcctgactgtgcc
ccgccctttgactttgcctttgatcgtgaagccctcactcgggagcgcattaaggaggcc
atcgtggctgagattgaggacttccatgcaaggcgcgagggcatccgccagcagatccgc
ttccagccttctctccagcctgtggctagtgaacctggctgtccagatgttgaaatgccc
agtccctgggctcccagtggggactgtgccatggagtctcccccaccagccccaccaccg
tgccctggccctgcacctgacaccattgatctgaccctgcagccacccccaccagccagt
gagcctgccccaccgaagaaagagggtgccatctcagacaacactaaggctgcccttaaa
gctgccctgctcaagtctttgagaagccggctcagagatggccccagcgcacccctggag
gcttctgagcctcggaagccggtgacagcccaggagcgccagcgggagcgggaggagaag
cggcggcggcggcaagagcgagccaaggagcgggagaaacggcggcaggagcgggagcga
aaggaacggggggccggggcctctgggggcccctccactgaccctttggctggactagtg
ctcagcgacaatgacagaagccttttggaacgctggactcgaatggcccgacccccagcc
ccagccccgacctctgtgccagcccctgccccagtgccaacgccaaccccagcccaacct
gccagtcctcctcctggccctgtagcccagcccactggcccacaaccacaaccacaacct
gtgggctccacatctggccctgtaccccagcctgcctgcccaccccctggccctgcagcc
caccccaccggccctcctaggcccatccctgtccctgcgccaccccagattgccacctct
accagcctcctggctccccagtcacttgtgccaccccctgggttgcctggctccaacacc
ccaggagttttgccttacttcccacctggcctgccacctacagacgccgggggagcccct
cagtcttccatgtcagagtcacctgatgtcaacctagtgacccagcagctatctaagtca
caggtggaggaccccctgccccctgtgttctcaggcacaccaaagggcagtggggctggc
tacggtgttggctttgacctggaggaattcttaaaccagtctttcgacatgggcgtggct
gatgggccacaggatggccagtcagattcagcctcactctcagcctccctgcttgctgac
tggctcgaaggccatggcatgaaccctgccgatattgagtccctgcagcgtgagatccag
atggactccccaatgctgctggctgacctgcctgacctccaggacccctga

DBGET integrated database retrieval system