KEGG   Macaca mulatta (rhesus monkey): 703449
Entry
703449            CDS       T01028                                 

Gene name
SLC22A1
Definition
(RefSeq) solute carrier family 22 member 1 isoform X1
  KO
K08198  MFS transporter, OCT family, solute carrier family 22 (organic cation transporter), member 1
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04976  Bile secretion
mcc05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09150 Organismal Systems
  09154 Digestive system
   04976 Bile secretion
    703449 (SLC22A1)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    703449 (SLC22A1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mcc02000]
    703449 (SLC22A1)
Transporters [BR:mcc02000]
 Solute carrier family (SLC)
  SLC22: Organic cation/anion/zwitterion transporter
   703449 (SLC22A1)
 Major facilitator superfamily (MFS)
  Organic acid transporters
   Organic cation transporter (OCT) family [TC:2.A.1.19]
    703449 (SLC22A1)
SSDB
Motif
Pfam: Sugar_tr MFS_1
Other DBs
NCBI-GeneID: 703449
NCBI-ProteinID: XP_014993118
Ensembl: ENSMMUG00000015662
LinkDB
Position
4
AA seq 554 aa
MPTVDDILEQVGEFGWFQKQAFLTLCLMSAAFGPICVGIVFLGFTPDHRCQSPGVAELSQ
RCGWSHAEELNYTVPGRGPLDEAFLSQCRRYEVDWNQSALSCVDPLASLATNRSHLPLGP
CQDGWVYDTPGSSIVTEFNLVCADSWKLDLFQSCLNAGFLFGSLGIGYVADRFGRKLCLL
GTVLVNAVSGVLMAFAPNYISMLFFRLLQGLVSKGNWMAGYTLITEFVGSGSRRTVAIMY
QMAFTMGLVALTGLAYVLPHWRWLQLAVSLPTFLFLLYYWCVPESPRWLLSQKRNTQAIK
IMDHIAQKNGKLPPADLKMLSLEQDVTEKLSPSFADLFRTPRLRKHTFILMYLWFTASVL
YQGLILHMGATSGNLYLDFLYSALVEFPGAFITLITIDRVGRIYPTAVSNLLAGAACLVM
IFISPDPHWLNIILMCVGRMGITIAFQMICLVNAELYPTFVRNLGVMVCSSLCDIGGIIT
PFIVFRLMEVWQALPLILFGVLGLLAAGVTLLLPETKGVALPETMKDAENLGRKAKPKEN
TIYLEVQTSEPLGT
NT seq 1665 nt   +upstreamnt  +downstreamnt
atgcccactgtagatgacattctggagcaggttggggagtttggctggttccagaagcaa
gccttcctcaccctatgcctaatgtcagctgcctttgggcccatctgtgtgggcatcgtc
ttcctgggcttcacacctgaccaccgctgccagagccccggggtggctgagctgagccag
cgctgtggctggagccatgcggaggagctaaactatacagttccaggccgagggcctttg
gacgaggccttccttagccagtgcaggcgctatgaagtggactggaaccagagcgccctc
agctgcgtagaccccctggctagcctggccaccaacaggagccacctgccgctgggcccc
tgccaggatggttgggtgtacgacactcctggctcctccatcgtcaccgagttcaacctg
gtgtgtgctgactcctggaagctggacctctttcagtcctgtttgaatgcgggcttcttg
tttggctctctgggcattggctacgttgcagacaggtttggccgtaagctgtgtctcctg
ggtaccgtgctggtcaacgccgtgtcgggtgtgctcatggcctttgcgcccaactacata
tccatgctgttcttccgcctgctgcagggcctggtcagcaagggcaactggatggccggc
tacaccctaatcacagaatttgttggctcgggctccagaagaacggtggcgatcatgtac
cagatggccttcaccatggggctggtggcgcttaccgggctggcctacgtcctgcctcac
tggcgctggctgcagctggcagtctccctgcccaccttcctcttcctgctctactactgg
tgtgtgccggagtcccctcggtggctgttatcacaaaaaagaaacactcaagcaataaag
atcatggaccacatcgctcaaaagaatgggaagctgcctcctgctgatttaaagatgctc
tccctcgaacaggatgtcactgaaaagctgagcccttcgtttgcagacctgttccgcacg
ccacgcctgaggaagcacaccttcatcctgatgtacctgtggttcaccgcctctgtgctc
tatcaggggctgatcctgcacatgggcgccaccagcgggaacctctacctggatttcctt
tactccgcactggtcgaattcccgggggccttcatcaccctcatcaccattgaccgcgtg
ggccgcatctaccccacagctgtgtcaaatctgttggcgggagcagcctgccttgtcatg
atttttatttcacctgacccgcactggttaaacatcatactcatgtgtgttggccgaatg
ggaatcaccattgcattccaaatgatctgcctggtgaatgctgagctgtaccctacattt
gtcaggaacctcggagtgatggtgtgttcctccctgtgtgacataggtgggataatcacc
cccttcatagtcttcaggctgatggaggtttggcaagcgttgcctctcattttatttggg
gtgttgggcctgcttgccgcgggagtgacgctacttcttccggagaccaagggggtcgct
ttgccagagaccatgaaggacgccgagaaccttggcagaaaagcaaagcccaaagaaaac
acaatttaccttgaggtccaaacatcagaacccttgggcacctga

KEGG   Macaca mulatta (rhesus monkey): 704729
Entry
704729            CDS       T01028                                 

Gene name
SLC44A5
Definition
(RefSeq) choline transporter-like protein 5 isoform X1
  KO
K15377  solute carrier family 44 (choline transporter-like protein), member 2/4/5
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    704729 (SLC44A5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mcc02000]
    704729 (SLC44A5)
   04147 Exosome [BR:mcc04147]
    704729 (SLC44A5)
Transporters [BR:mcc02000]
 Solute carrier family (SLC)
  SLC44: Choline-like transporter
   704729 (SLC44A5)
Exosome [BR:mcc04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   704729 (SLC44A5)
SSDB
Motif
Pfam: Choline_transpo
Other DBs
NCBI-GeneID: 704729
NCBI-ProteinID: XP_001100356
Ensembl: ENSMMUG00000017907
UniProt: F7GW35
LinkDB
Position
1
AA seq 719 aa
MNDTEKPADTASEEEDFGDPRTYDPDFKGPVSNRSCTDVLCCMIFLLCIVGYIVLGLVAW
VHGDPRRAAYPTDSQGHFCGQKGTPNENKTILFYFNLLRCTSPSVLLNLQCPTTQICVSK
CPEKFLTYVEMQLLYTKDKSHWEDYRQFCKTTAKPVKSLTQLLLDDDCPTAIFPSKPFLQ
RCFPDFSTKNGTLTIGSQIVFQDGNGGTRSVIELRDAANGINKLLDAKSLGLKVFEDYAT
TWYWILIGLMIAMVLSWIFLILLRFIAGCLFWVFMIGVIGIIGYGIWHCYQQYTNLQEHP
RSVLTVYDIGIQTNISMYFELQQTWFTLMIILCIIEVIVILMLIFLRNRIRVAIILLKEG
SKAIGYVPSTLVYPALTFILLSICICYWVVTAVFLATSGVPVYKVIAPEGHCIHENQTCD
PEIFNTTEIAKACPGALCNFAFYGGKSLYHQYIPTFHVYNLFVFLWLINFVIALGQCALA
GAFATYYWAMKKPDDIPRYPLFTAFGRAIRYHTGSLAFGSLIIALIQMFKIVLEYLNHRL
KRTENTLSKFLQCCLRCCFWCLENAIKFLNRNAYIMIAIYGRNFCRSAKDAFNLLMRNVL
KVAVTDEVTYFVLFLGKILVAGSIGVLAFLFFTQRLPVIAQGPASLNYYWVPLLTVILGS
YLIAHGFFSVYAMCVETIFICFCEDLERNDGSTEKPYFITPNLHGILIKKQLVPQKQKE
NT seq 2160 nt   +upstreamnt  +downstreamnt
atgaatgacacagaaaaaccagcagatactgcctctgaggaagaggactttggtgatcca
aggacatatgacccagatttcaaggggcctgtttccaacaggagttgtacagatgttctg
tgctgtatgatcttcctactgtgtattgttggctacattgttttaggacttgtggcctgg
gtacatggggaccccagaagagcagcctatcctacagacagccagggccacttttgtggc
cagaagggcacccccaatgagaacaagaccattttgttttactttaacctgttacgctgt
accagtccctccgtgttgctaaacctacagtgccctaccacacagatctgtgtctccaag
tgcccagaaaaatttttaacctatgtggaaatgcaacttttgtacacaaaagacaaaagc
cactgggaagactaccgtcagttctgtaagaccactgctaagcctgtgaagtccctcaca
caacttttactggatgatgactgtccaacagcgatttttccaagcaaaccttttctccag
agatgtttccctgacttctctaccaaaaatggcactttaacaataggaagtcagatcgtg
tttcaagatggaaatggagggacaagaagtgttatcgaactcagggatgctgcgaatggt
atcaataaacttcttgatgcaaagtcacttggattgaaagtgtttgaagactatgcaaca
acttggtattggattctcattggcctgatgatcgccatggtccttagttggatatttttg
atacttctgaggttcatagctggatgcctcttctgggtcttcatgatcggtgtgattgga
attatcggttatggaatatggcactgttaccaacagtacaccaatcttcaggaacaccca
cgttctgtattaactgtctatgacatcgggattcagactaacataagcatgtactttgaa
ctgcaacaaacatggttcacattgatgataatactctgcatcattgaagtgattgtcatc
ctcatgctgatcttcctcaggaatcgaatccgagtcgccattatcctgctgaaggaagga
agcaaagccattggatacgttcctagtacattagtctatccagctttaactttcatttta
ctctcaatctgtatttgctactgggtcgtgacagcagttttcttggcgacatcaggggta
cccgtgtacaaagtcatagctccagaggggcattgtatacatgaaaatcaaacctgtgac
ccagagatttttaatacaactgaaattgccaaagcttgccctggggctctgtgtaacttt
gctttctatggtggaaagagcttgtaccatcaatacatccctaccttccatgtatacaac
ttatttgtctttctctggcttataaactttgtcattgcattgggtcagtgtgcccttgct
ggtgcattcgctacttattactgggccatgaaaaaacctgatgacatcccacgatatcca
ctttttactgcatttgggcgagccatacgatatcacacaggatccctagcatttggatct
ttaattattgcattaattcaaatgtttaaaattgtcctagaatacttgaaccaccgtctt
aaacgtaccgagaacacattgtctaaattcctacaatgctgcctgagatgctgcttctgg
tgtttggaaaatgcaataaagtttttaaacagaaatgcctatattatgattgcaatatat
ggcagaaacttctgcaggtcagcaaaagatgctttcaatctgctgatgagaaatgtttta
aaagttgcagttacagatgaagttacatactttgtattattcctggggaaaattctagtt
gctggaagtataggtgttctggccttcctattcttcacacaaagactgccagtgattgca
caaggaccagcatctttaaattactactgggtacctttgctgacggtcattttggggtct
tacctgattgcacatgggttcttcagcgtctatgcaatgtgtgttgaaacaattttcatc
tgcttctgtgaagatctggaaagaaatgatggatctacagaaaaaccctacttcataacc
cctaacctgcacggaattctgatcaagaagcaactagttccccagaagcagaaagagtag

KEGG   Macaca mulatta (rhesus monkey): 707590
Entry
707590            CDS       T01028                                 

Gene name
SLC22A5
Definition
(RefSeq) solute carrier family 22 member 5 isoform X1
  KO
K08202  MFS transporter, OCT family, solute carrier family 22 (organic cation transporter), member 4/5
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    707590 (SLC22A5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mcc02000]
    707590 (SLC22A5)
Transporters [BR:mcc02000]
 Solute carrier family (SLC)
  SLC22: Organic cation/anion/zwitterion transporter
   707590 (SLC22A5)
 Major facilitator superfamily (MFS)
  Organic acid transporters
   Organic cation transporter (OCT) family [TC:2.A.1.19]
    707590 (SLC22A5)
SSDB
Motif
Pfam: Sugar_tr MFS_1
Other DBs
NCBI-GeneID: 707590
NCBI-ProteinID: XP_001103789
Ensembl: ENSMMUG00000007087
LinkDB
Position
6
AA seq 557 aa
MRDYDEVTAFLGEWGPFQRLIFFLLSASIIPNGFTGLSSVFLIATPEHRCRVPDAANLSS
AWRNHSVPLRLRDGREVPHSCRRYRLATIANFSALGLEPGRDVDLGQLELESCLDGWEFS
RDVYLSTIVTEWNLVCEDDWKAPLTISLFFVGVLLGSFVSGQLSDRFGRKNVLFVTMGMQ
TGFSFLQIFSKNFEMFVMLFVLVGMGQISNYVAAFVLGTEILGKSVRIIFSTLGVCIFYA
FGYMVLPLFAYFIRDWRILLVALTMPGVLCVALWWFIPESPRWLISQGRFEEAEVIIRKA
AKANGIVVPSTIFDPSELQDLSSKKQQSHNILDLLRTWNIRMVTIMSIMLWMTISVGYFG
LSLDTPNLHGDIYVNCFLSAVVEVPAYVLAWLLLQYLPRRYSMATALFLGGSVLLFVQLV
PPDLYYLATVLVMVGKFGVTAAFSMVYVYTAELYPTVVRNMGVGVSSTASRLGSILSPYF
VYLGAYDRFLPYILMGSLTILTAILTLFLPESFGTPLPDTIDQMLRVKGMKHRKTPSHTR
MLKDGQERPTILKSTAF
NT seq 1674 nt   +upstreamnt  +downstreamnt
atgcgggactacgacgaggtgaccgccttcctgggcgagtgggggcctttccagcgcctc
atcttcttcctgctcagcgccagcatcatccctaatggcttcaccggcctgtcctccgtg
ttcctgatagcgaccccggagcaccgctgccgggtgccggacgccgcgaacctaagcagc
gcctggcgcaaccacagtgtcccactgcggctgcgggacggccgcgaggtgccccacagc
tgccgccgctaccggctcgccaccatcgccaacttctcggcgctcgggctggagccgggg
cgcgacgtggacctggggcaactggagctggagagctgcctggatggctgggagttcagc
cgggacgtctatctgtccaccattgtgaccgagtggaacctggtgtgtgaggacgactgg
aaggccccactcacgatctccttgttcttcgtgggtgtgctgttgggctccttcgtttca
gggcagctgtcagacaggtttggccggaagaatgtgctgttcgtgaccatgggcatgcag
acaggcttcagcttcctgcagatcttctcaaaaaactttgagatgtttgtcatgctgttt
gtccttgtaggcatgggccagatctccaactatgtggcagcatttgtcctgggaacagaa
attcttggcaagtcagttcgtataatattctctacgttaggagtatgcatattttatgca
tttggctacatggtgctcccactgtttgcttacttcatccgagactggcgaatactgctg
gtggcactgacgatgccaggggtgctgtgcgtggcactctggtggttcatccctgagtcc
ccccgatggctcatctctcagggacgatttgaagaggcagaggtgatcatccgcaaggct
gccaaagccaatggaattgttgtgccttccaccatctttgacccaagtgagttacaagac
ctaagttccaagaagcagcagtcccacaacattctggatctgcttcgaacctggaatatc
cggatggtcaccatcatgtccataatgctgtggatgaccatatcagtgggctatttcggg
ctttcccttgatactcctaacttgcatggggacatctatgtgaactgcttcctttcagcg
gtggttgaagtcccagcatacgtgttggcctggctgctgctgcaatatttgccccggcgc
tattccatggccactgccctcttcctgggtggcagtgtccttctcttcgtacaactggta
cccccagacttgtattatttggctacagtcctggtgatggtgggcaagtttggagtcacg
gctgccttttccatggtctacgtgtacacagctgagctgtatcccacggtggtgagaaac
atgggtgtgggagtcagctccacagcatcccgcctgggcagcatcctgtctccctacttc
gtttaccttggtgcctacgaccgcttcctgccctacattctcatgggaagtctgaccatc
ctgacagccatcctcaccttgtttctcccagagagcttcggtaccccactcccggacacc
attgaccagatgctgagagtcaaaggaatgaaacacagaaaaactccaagtcacacaagg
atgttaaaagatggtcaagaaaggcccacaatccttaaaagcacagccttctaa

KEGG   Macaca mulatta (rhesus monkey): 708988
Entry
708988            CDS       T01028                                 

Gene name
SLC22A2
Definition
(RefSeq) solute carrier family 22 member 2 isoform X1
  KO
K08199  MFS transporter, OCT family, solute carrier family 22 (organic cation transporter), member 2
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    708988 (SLC22A2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mcc02000]
    708988 (SLC22A2)
Transporters [BR:mcc02000]
 Solute carrier family (SLC)
  SLC22: Organic cation/anion/zwitterion transporter
   708988 (SLC22A2)
 Major facilitator superfamily (MFS)
  Organic acid transporters
   Organic cation transporter (OCT) family [TC:2.A.1.19]
    708988 (SLC22A2)
SSDB
Motif
Pfam: Sugar_tr MFS_1
Other DBs
NCBI-GeneID: 708988
NCBI-ProteinID: XP_028702836
Ensembl: ENSMMUG00000005715
LinkDB
Position
4
AA seq 555 aa
MTTTVDDALEHGGEFHFFQKQMFFLLSLLSVAFTPIYVGIVFLGFTPDHRCRSPGVAELS
LRCGWSPAEELNYTVPGPGPGGEASARQCRRYEVDWNQSTLSCADPLASLDTNRSRLPLG
PCRDGWLYETPGSSIVTEFNLVCANSWMLDLFQSSVNVGFFIGSMSIGYIADRFGRKLCL
LTTILINAASGVLMAISPTYTWMLIFRLIQGLVSKASWLIGFILITEFVGRSYRRTVGIF
YQAAFTVGLLMLAGVAYALPHWRWLQFTVTLPNFCFLLYYWCIPESPRWLISQNKNAEAM
RIFKHIAKKNGKSLPASLQRLRLEEETGKKLNPSFLDLVRTPQIRKHTLILMYNWFTSSV
LYQGLIMHMGLAGDNIYLEFFYSALVEFPAAFMVILTIDRIGRRYPWAASNIVAGAACLA
SGFIPGDLRWLRIIVSCLGRMGITMAYEIVCLVNAELYPTFIRNLGVHVCSSMCDIGGII
TPFLVYRLTNIWLELPLMVFAVVGLVAGGLVLLLPETKGKALPETIEEAENMQRPRKNKE
KMIYLQVQKLDIPLN
NT seq 1668 nt   +upstreamnt  +downstreamnt
atgaccaccaccgtggacgatgccctggagcatggaggggagttccactttttccagaag
caaatgtttttcctcttatctctgctctcggttgccttcacgcccatctacgtgggcatc
gtcttcctgggcttcacccctgaccaccgctgccggagccccggagtggccgagttgagt
ctgcgctgtggctggagtcctgcagaggagctgaactacacggtgccgggcccaggacct
gggggcgaggcctccgcaagacagtgcaggcgctacgaggtggactggaaccagagcacc
ctcagctgcgcggaccccctggccagcctggacaccaacaggagccgcctgccactgggc
ccctgccgggacggctggttgtacgagacgcctggctcctccatcgtcaccgagtttaac
ctggtatgtgccaactcctggatgttggacctattccagtcatcggtgaatgtaggattc
tttatcggttctatgagcatcggctacatagcagacaggtttggccgtaagctctgcctc
ctaactacaatcctcataaatgctgcatctggagttctcatggccatttccccaacctat
acatggatgttaatttttcgcttaatccaaggattggtcagcaaagcaagctggttaata
ggcttcatcctgattacagaatttgttgggcggagctatcggagaacagtggggattttt
taccaagctgcctttacagttgggctcctgatgctagctggtgtggcttacgcccttcct
cactggaggtggttgcagttcacagttactctgcccaacttctgcttcttgctctattac
tggtgcatacctgagtctcccaggtggctgatctcccagaataagaatgctgaagccatg
agaatctttaagcacattgcaaagaaaaatggaaaatctctacctgcctcccttcagcgc
ctgagacttgaagaggaaactggcaagaaactgaatccttcatttcttgacttggtcaga
actcctcagataaggaaacatactttgatattgatgtacaactggttcacgagctctgta
ctctaccagggcctcatcatgcacatgggccttgcaggggacaatatctacctggaattc
ttctactctgccctggttgaattcccagctgccttcatggtcatcctcaccatcgaccgc
atcggccgccgttacccttgggctgcatcaaatatagttgcaggggcagcctgtctggcc
tcaggttttatccctggtgatctacgatggctaagaattattgtctcatgcttgggaaga
atggggatcacaatggcctatgagatagtctgcctggtcaatgctgaactgtaccccaca
ttcattaggaatcttggcgtccacgtctgttcctcaatgtgtgacattggtggcatcatc
acgccattcctggtctaccggcttactaacatctggcttgagctcccactgatggttttt
gccgtggttggcttggttgctggaggtctggtgctgttgctacccgaaactaaagggaag
gctttgcctgagaccatcgaggaagccgaaaatatgcagagaccaagaaaaaataaagaa
aagatgatttacctccaagttcagaaactagacattccattgaactaa

KEGG   Macaca mulatta (rhesus monkey): 709454
Entry
709454            CDS       T01028                                 

Gene name
SLC22A3
Definition
(RefSeq) solute carrier family 22 member 3
  KO
K08200  MFS transporter, OCT family, solute carrier family 22 (organic cation transporter), member 3
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    709454 (SLC22A3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mcc02000]
    709454 (SLC22A3)
Transporters [BR:mcc02000]
 Solute carrier family (SLC)
  SLC22: Organic cation/anion/zwitterion transporter
   709454 (SLC22A3)
 Major facilitator superfamily (MFS)
  Organic acid transporters
   Organic cation transporter (OCT) family [TC:2.A.1.19]
    709454 (SLC22A3)
SSDB
Motif
Pfam: Sugar_tr MFS_1
Other DBs
NCBI-GeneID: 709454
NCBI-ProteinID: XP_014993126
Ensembl: ENSMMUG00000005717
UniProt: F6TY97
LinkDB
Position
4
AA seq 555 aa
MPSFDEALQRAGEFGRFQRRVFLLLCLTGITFAFLFVGVVFLGTQPDHYWCRGPSAAALA
ERCGWSPEEEWNRTAPASRGPEPPERRGRCQRYLLEAANYSAAATSALGCADPLAAFPNR
SAPLVPCRGGWRYAQAHSTIISEFDLVCVNAWMLDLTQAILNLGFLTGAFTLGYAADRYG
RIVIYLLSCLGVGVTGVVVAFAPNFPVFVIFRFLQGVFGKGTWMTCYVIVTEIVGSKQRR
IVGIVIQMFFTLGIIILPGIAYFIPNWQGIQLAITLPSFLFLLYYWVVPESPRWLITRKK
GDKALQILRRIAKCNGKYLSSSYSQITVTDEEVSNPSFLDLVRTPQMRKCTLILMFAWFT
SAVVYQGLVMRLGIIGGNLYIDFFISGVVELPGALLILLTIERLGRRLPFAASNIVAGVA
CLVTAFLPEGIPLLRTTVATLGRLGITMAFEIVYLVNSELYPTTLRNFGVSLCSGLCDFG
GIIAPFLLFRLAAVWLELPLIIFGILASICGGLVMLLPETKGIALPETVDDVEKLGSPHS
YKCGRNKTPVSSSHL
NT seq 1668 nt   +upstreamnt  +downstreamnt
atgccctccttcgacgaggcgctgcagcgggcgggcgagttcgggcgcttccagaggcgc
gtgttcctgctgctgtgcctgacgggcatcaccttcgccttcctcttcgtcggcgtggtc
ttcctgggcacgcagcccgaccactattggtgccgcgggccaagtgccgcggcgttggcc
gagcgctgcggctggagcccggaggaggagtggaaccgcacggcgcccgcctcccgcggc
ccggagcccccggagcgccgcggccgctgccagcgctacctcctggaggcggccaactac
agcgccgccgccactagcgcgctcggctgtgcggacccactagccgccttccccaaccgt
tcggcgccccttgtgccgtgccgcggcggctggcgctatgcccaggcccactccaccatc
atcagcgagtttgaccttgtctgtgtcaatgcatggatgctggaccttacccaagccatc
ctgaaccttggcttcctgactggagcattcaccttaggctatgcagcggacaggtatggc
aggatcgtcatttacttgctctcttgccttggtgttggcgtcactggggttgtggtggcc
tttgcaccaaacttccctgtgtttgtgatcttccgcttcctgcaaggtgtgtttggaaag
gggacatggatgacttgctacgtgattgtgacagaaatagtaggttcgaaacaaaggagg
attgtgggaatcgtgattcaaatgttttttacccttggaatcataattctccctggaatt
gcctacttcatccccaattggcaaggaatccagttagccatcacgctgcccagctttctc
ttcctcctttattactgggttgtccccgagtctccccgttggctgattactcggaagaaa
ggagataaagcattacagatcctgagacgcattgctaagtgcaatgggaaatacctctca
tcaagttactcacagatcactgttacagatgaggaagttagtaatccatcctttttagat
ctggtgagaactccccaaatgaggaaatgcacacttattcttatgtttgcttggttcaca
agtgcagtggtgtatcaaggacttgtcatgcgcctgggaattataggaggcaacctctat
atagactttttcatctcgggagtggtggaactgccaggagctctcttgatcttactaacc
attgagcgccttggacgacgcctcccctttgcggcaagcaatatagtggcgggggtggca
tgccttgtcactgcattcttaccagaaggaataccattgttgaggaccacagtggctaca
ctgggaagactagggataaccatggcctttgaaattgtttatttggtaaattcagaattg
tacccaacaacattacgaaatttcggagtttcgctctgttcaggtctgtgtgattttggg
ggaatcatagccccatttctcctctttcggctagcagccgtgtggctagaactacctctg
atcatctttggtatcctggcatccatttgtggtggcctcgtgatgcttttgcccgaaacc
aagggtattgccttgccagagacagtggatgatgtagaaaaacttggcagtccacattcc
tataaatgcggcaggaataaaaccccagtttccagctctcacctttga

KEGG   Macaca mulatta (rhesus monkey): 710179
Entry
710179            CDS       T01028                                 

Gene name
SLC22A4
Definition
(RefSeq) solute carrier family 22 member 4 isoform X1
  KO
K08202  MFS transporter, OCT family, solute carrier family 22 (organic cation transporter), member 4/5
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    710179 (SLC22A4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mcc02000]
    710179 (SLC22A4)
Transporters [BR:mcc02000]
 Solute carrier family (SLC)
  SLC22: Organic cation/anion/zwitterion transporter
   710179 (SLC22A4)
 Major facilitator superfamily (MFS)
  Organic acid transporters
   Organic cation transporter (OCT) family [TC:2.A.1.19]
    710179 (SLC22A4)
SSDB
Motif
Pfam: Sugar_tr MFS_1
Other DBs
NCBI-GeneID: 710179
NCBI-ProteinID: XP_002804554
Ensembl: ENSMMUG00000009301
LinkDB
Position
6
AA seq 551 aa
MRDYDEAIAFLGEWGPFQRLIFFLLSASIIPNGFNGMSVVFLAGTPEHRCRVPDAANLSS
AWRNNSVPLRLRDGREVLHSCRRYRLATIANFSALGLEPGRDVDLGQLEQESCLDGWEFS
QDVYWSTVVTEWNLVCEDNWKVPLTTSLFFVGVLLGSFLSGQLSDRFGRKNVLFATMAVQ
TGFSFLQIFSISWEMFTVLFLIVGMGQISNYVVAFILGTEILGKSVRIIFSTLGVCTFFA
VGYMLLPLFAYFIRDWRMLLLALTVPGVLCVPLWWFIPESPRWLISQRRFREAEDIIQKA
AKMNNIAVPAVIFDSVEELNPLKQQKAFILDLFRTWNIAIMTIMSLLLWMLTSVGYFALS
LDTPNLHGDAYLNCFLSALIEIPAYITAWLLLRTLPRRYIIAAVLFWGGGVLLFIQLVPV
DYYFLSIGLVMLGKFGITSAFSMLYVFTAELYPTLVRNMAVGVTSMASRVGSIIAPYFVY
LGAYNRMLPYIVMGSLTVLIGILTLFFPESLGMTLPETLEQMQKVKWFRSGKKTRDSMET
EENPKVLITAF
NT seq 1656 nt   +upstreamnt  +downstreamnt
atgcgggactacgacgaggcgatcgccttcctgggcgagtggggacccttccagcggctc
atcttcttcctgctcagcgccagcatcatccccaatggcttcaatggtatgtcagtcgtg
ttcctggcggggaccccagagcaccgctgccgggtgcctgacgccgcgaacctgagcagc
gcctggcgcaacaacagtgtcccgctgcggctgcgggacggccgcgaggtgctccacagc
tgccgccgctaccggctcgccaccatcgccaacttctcggcgctcgggctagagccgggg
cgcgacgtggacctgggacagctggagcaggagagctgcctggatggctgggagttcagc
caagacgtctactggtccaccgtcgtgactgagtggaatctggtgtgtgaggacaactgg
aaggtgcccctcaccacctccctgttcttcgtaggagtgctcctcggctccttcctttcc
gggcaactgtcagacaggtttggcaggaagaacgttctcttcgcaaccatggctgtacag
actggcttcagcttcctgcagattttctccatcagctgggagatgttcactgtgttattt
ctcatcgtgggcatgggccagatctccaactatgtggtagccttcatactaggaacagaa
attcttggcaagtcagttcgtattatattctctacattaggagtgtgcacattttttgca
gttggctatatgctgctgccactgtttgcttacttcatcagagactggcggatgctgctg
ctggcgctgacggtgccgggagtgctgtgcgtcccgctgtggtggttcattcctgaatct
ccccgatggctgatatcccagagaagatttagagaggctgaagatatcatccaaaaagct
gcaaaaatgaacaacatagctgtaccagcagtgatatttgattctgtggaggagctaaat
cccctgaagcagcagaaagctttcattctggacctattcagaacttggaatattgccata
atgaccattatgtctttgctgctatggatgctgacctcagtgggttactttgctctgtct
ctggatactcctaatttacatggagatgcctacctgaactgtttcctctctgctttgatt
gaaattccagcttacattacagcctggctgctattgcgaaccctgcccaggcgttatatc
atagctgcagtactgttctggggaggaggtgtgcttctcttcattcaactggtacctgtg
gattattacttcttatccattggtctggtcatgctgggaaaatttggaatcacctctgct
ttctccatgctgtatgtcttcactgctgagctctacccaaccctggtcaggaacatggca
gtgggggtcacatccatggcctccagagtgggcagcatcattgccccctactttgtttac
ctcggtgcttacaacagaatgctgccctacatcgtcatgggtagtctgactgtcctgatt
ggaattctcaccctttttttccctgaaagtttaggaatgactcttcccgaaaccttagag
cagatgcagaaagtgaaatggttcagatctgggaaaaaaacaagagactcaatggagaca
gaagaaaatcccaaggttctaataactgcattctga

KEGG   Macaca mulatta (rhesus monkey): 714093
Entry
714093            CDS       T01028                                 

Gene name
SLC5A7
Definition
(RefSeq) high affinity choline transporter 1
  KO
K14387  solute carrier family 5 (high affinity choline transporter), member 7
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04725  Cholinergic synapse
mcc05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09150 Organismal Systems
  09156 Nervous system
   04725 Cholinergic synapse
    714093 (SLC5A7)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    714093 (SLC5A7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mcc02000]
    714093 (SLC5A7)
Transporters [BR:mcc02000]
 Solute carrier family (SLC)
  SLC5: Sodium glucose cotransporter
   714093 (SLC5A7)
SSDB
Motif
Pfam: SSF
Other DBs
NCBI-GeneID: 714093
NCBI-ProteinID: XP_014968551
Ensembl: ENSMMUG00000010166
LinkDB
Position
13
AA seq 580 aa
MTFHVEGLIAIIVFYLLILLVGIWAAWRTKNSGSAEERSEAIIVGGRDIGLLVGGFTMTA
TWVGGGYINGTAEAVYVPGYGLAWAQAPIGYSLSLILGGLFFAKPMRSKGYVTMLDPFQQ
IYGKRMGGLLFIPALMGEMFWAAAIFSALGATISVIIDVDVNISVIISALVATLYTLVGG
LYSVAYTDVVQLFCIFVGLWISVPFALSHPAVADIGFTAVHAKYQKPWLGTVDSSEVYSW
LDSFLLLMLGGIPWQAYFQRVLSSSSATYAQVLSFLAAFGCLVMAVPAILIGAIGASTDW
NQTAYGLPDPKTTDEADMILPIVLQYLCPVYISFFGLGAVSAAVMSSADSSILSASSMFA
RNIYQLSFRQNASDKEIVWVMRITVFVFGASATAMALLTKTVYGLWYLSSDLVYIVIFPQ
LLCVLFVKGTNTYGAVAGYVSGLFLRITGGEPYLYLQPLIFYPGYYPDDNGIYNQKFPFK
TLAMVTSFLTNICISYLAKYLFESGSLPPKLDLFDAVVARHSEENMDKTILVKNENIKLD
ELALVKPRQSMTLSSTFTNKEAFLDVDSSPEGSGTEDNLQ
NT seq 1743 nt   +upstreamnt  +downstreamnt
atgactttccatgtggaaggactgatagctatcatcgtgttctaccttctcattttgctg
gttggaatatgggctgcctggagaaccaaaaacagtggcagcgcagaagaacgcagcgaa
gccatcatagttggtggccgagatattggtttattggttggtggatttaccatgacagct
acctgggtcggaggagggtatatcaatggcacagctgaagcagtttatgtaccaggttat
ggcctagcttgggctcaggcacccattggatattctcttagtctgattttaggtggcctg
ttctttgcaaaacctatgcgttcaaaggggtatgtgaccatgttagacccgtttcagcaa
atctatggaaaacgcatgggcggactcctgtttatacctgcactgatgggagaaatgttc
tgggctgcagcaattttctctgctttgggagccaccatcagtgtgatcattgacgtggat
gtgaacatttctgtcatcatctctgcactcgttgccactctgtacaccctggtgggaggg
ctctattctgtggcctacaccgatgttgttcagctcttttgcatttttgtggggctgtgg
atcagcgtcccctttgcattgtcacatcctgcagtcgcagacatcgggttcactgctgtg
catgccaaataccaaaagccgtggctgggaactgttgactcatctgaagtctactcttgg
cttgatagttttctgttgttgatgctgggtggaatcccatggcaagcgtacttccagagg
gttctctcttcatcttcagccacctatgctcaagtgctgtcattcctggcagctttcggg
tgcctggtaatggctgtcccagccatactcattggggccattggagcatcaacagactgg
aaccagactgcatatgggcttccagatcccaagactacagatgaagcagacatgatttta
ccaattgttctgcagtatctctgccctgtgtatatttctttctttggtcttggtgcagtt
tctgctgctgttatgtcatcagcagactcttccatcttgtcagcaagttccatgtttgca
cggaacatctaccagctttccttcagacaaaatgcttcggacaaagaaatcgtttgggtc
atgcgaatcacagtatttgtgtttggagcatctgcaacagccatggccttgctgacgaag
actgtgtatgggctctggtacctcagttctgaccttgtttacatcgttatcttcccccag
ctgctttgtgtactctttgttaagggaaccaacacctatggggctgtggcaggttatgtt
tctggcctcttcctgagaataactggaggggagccatacctctatcttcagcccttgatc
ttctaccctggctattaccctgatgataatggtatatataatcagaaattcccatttaaa
acacttgccatggttacttcattcttaaccaacatttgcatctcctatctagccaaatat
ctatttgaaagtggaagcttgccacctaaattagatctatttgatgctgttgttgcaaga
cacagtgaagaaaacatggataagacaattcttgtcaaaaatgaaaatattaaattagat
gaacttgcacttgtgaagccgcgacagagcatgaccctcagctcaactttcaccaataaa
gaggccttccttgatgttgattccagtccagaaggttctgggactgaagataatttacag
tga

KEGG   Macaca mulatta (rhesus monkey): 714768
Entry
714768            CDS       T01028                                 

Gene name
SLC44A3
Definition
(RefSeq) choline transporter-like protein 3 isoform X1
  KO
K15282  solute carrier family 44 (choline transporter-like protein), member 3
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    714768 (SLC44A3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mcc02000]
    714768 (SLC44A3)
Transporters [BR:mcc02000]
 Solute carrier family (SLC)
  SLC44: Choline-like transporter
   714768 (SLC44A3)
SSDB
Motif
Pfam: Choline_transpo
Other DBs
NCBI-GeneID: 714768
NCBI-ProteinID: XP_015000939
Ensembl: ENSMMUG00000001686
LinkDB
Position
1
AA seq 651 aa
MHCLGAEYLVSAERAPRQREWRPQIYRKCTDTAWLFLFFLFWTGLVFIMGYSVVAGAAGR
LLFGYDSFGNVCGKKNSPVEGAPLSGQDMTLKKHVFFMNSCNQVKGMRLDRTALCVSSCP
EEQLDSLEEVQLFANTSGSFLCVYSLNSSNYTHSPKADSLCPRLPVPPSKSFPLFNRCIP
QTPECYSLFASVWINDGDTLHRILSGIMSGRDTILGLCILTLALSLAMMFTFRFITTLLV
NIFISLVILGLLFVCGVLWWLYYDYTNDLSIELDTERENMKCVLGFAIVSTGITAVLLVL
IFVLRKRIKLTVELFQITNKAISSAPFLLFQPLWTFAILIFFWVLWVAVLLSLGTAGAAQ
VMEGGQVEYKPLSGIRYMWSYHLIGLIWTSEFILACQQMTIAGAVVTCYFNRSKNDPPDR
PILSSLSILFFYHQGTVVKGSFLIPVVRLPRIIVMYMQNALKEQHGALSRYLFRCCYSCF
WCLDKYLLHLNQNAYTTTAINGTDFCTSAKDAFKILSKNSSHFTSINCFGDFIIFLGKVL
VVCFTVFGGLMAFNYNRAFQVWAVPLLLVAFFAYLVAHSFLSVFETVLDALFLCFAVDLE
TNDGSSEKPYFMDQEFLSFVKRSNKLNNARARQDEHSLRNDEGTELQAIAR
NT seq 1956 nt   +upstreamnt  +downstreamnt
atgcactgcctgggcgccgagtacctggtttctgcagaaagagcccctaggcaaagggag
tggcgaccccagatttataggaaatgcacagatacggcatggttattcctgttctttctc
ttttggactggtttggtgtttattatgggctactcagtggtggctggagctgcagggaga
ctcctcttcggctatgacagctttggcaacgtgtgtggcaagaagaactcccccgtggaa
ggggcccctctttcagggcaggacatgaccctaaaaaaacacgtgttctttatgaattcc
tgcaaccaagtcaaaggtatgcggctcgaccgcacggccctctgtgtatccagctgccct
gaagagcagcttgactccctggaagaggtccagctgtttgcaaacaccagtgggtctttc
ctgtgtgtttatagtttgaattcctccaactatacccacagtccaaaagcagactcactg
tgccccaggctaccagttcctccaagcaagtcatttcccttatttaaccgatgcatccct
caaacacctgagtgctactccctgtttgcatctgtttggataaatgatggtgacaccctc
caccgaattctaagtggaatcatgtcgggaagagatacaatccttggcctgtgtatcctc
acattagccttgtctttggccatgatgtttaccttcagattcatcaccacccttctggtt
aacattttcatttcattggttattttgggattgttgtttgtctgcggtgtcttatggtgg
ctgtattatgactataccaatgacctcagcatagaattggacacagaaagggaaaatatg
aagtgtgtgctggggtttgctatcgtatctacaggcatcacggcagtcctgctcgtcttg
atttttgttctcagaaagagaataaaattgacagttgagcttttccaaatcacaaataaa
gccatcagcagtgctcccttcctgctgttccagccactgtggacatttgccatcctcatt
ttcttctgggtcctctgggtggctgtgctgctgagcctgggaactgcaggagctgcccag
gttatggaaggcggccaagtggaatataagcccctttcgggcattcggtatatgtggtcc
taccatttaattggcctcatctggactagtgaattcatccttgcgtgccagcaaatgact
atagcaggggcagtggttacttgctatttcaacagaagtaaaaatgaccctcctgatcgt
cccatcctttcgtctctctccattctcttcttctaccatcaaggaaccgttgtgaaaggg
tcatttttaatccctgtggtgaggcttccaagaatcattgtcatgtacatgcaaaacgcg
ctgaaagaacagcatggtgcattgtcgaggtacctgttccgatgctgctacagctgtttc
tggtgtcttgacaaatacctgctccatctcaaccagaatgcatatactacaactgctatt
aatgggacagatttctgtacgtcagcaaaagatgcattcaaaatcttgtccaagaattca
agtcattttacatctattaactgctttggagacttcataatttttctaggaaaggtgtta
gtggtgtgtttcactgtttttggaggactcatggcttttaactacaatcgggcattccag
gtgtgggcagtccctctgttattggtagctttttttgcctacttagtagcccatagtttt
ttatctgtgtttgaaactgtgctggatgcacttttcctgtgttttgctgttgatctggaa
acaaatgatggatcgtcagaaaagccctactttatggaccaagaatttctgagttttgta
aaaaggagcaacaaattaaacaatgcaagggcacggcaggacgagcactcattaaggaat
gacgagggaacagaactccaggccattgcgagatag

KEGG   Macaca mulatta (rhesus monkey): 715779
Entry
715779            CDS       T01028                                 

Gene name
SLC44A4
Definition
(RefSeq) choline transporter-like protein 4 isoform X2
  KO
K15377  solute carrier family 44 (choline transporter-like protein), member 2/4/5
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    715779 (SLC44A4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mcc02000]
    715779 (SLC44A4)
   04147 Exosome [BR:mcc04147]
    715779 (SLC44A4)
Transporters [BR:mcc02000]
 Solute carrier family (SLC)
  SLC44: Choline-like transporter
   715779 (SLC44A4)
Exosome [BR:mcc04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   715779 (SLC44A4)
SSDB
Motif
Pfam: Choline_transpo
Other DBs
NCBI-GeneID: 715779
NCBI-ProteinID: XP_014991499
Ensembl: ENSMMUG00000021708
LinkDB
Position
4
AA seq 710 aa
MGGKQRDKDDEAYGKPVKYDPSFRGPIKNRSCTDVICCVLFLLFILGYIVVGIVAWLYGD
PRQVLYPRNSTGAYCGMGENKDKPYLLYFNIFSCILSTNIISVAENGLQCPTPQVCVSSC
PEAPWTVGKNQFSQTVGEVFYTKNRNFCLPGVPWNMMVITSLQQELCPSFLLPSAPALGR
CFPWTNVTLPELPGITNDTTIAQGISGLIDSLNARDISVKIFEDFAHSWYWILVALGVAL
VLSLLFILLLRLVAGPLVLVLILGVLGVLAYGIYYCWEEYRVLRDKGASISQLGFTTNLS
AYQSVQETWLAALIVLAVLEAILLLVLIFLRQRIRIAIALLKEASKAVGQMMSTMFYPLV
TFVLLLICIAYWAMTALYLATSGQPQYVLWASNISSPGCEKVSINTSCNPMDQPVNSSCP
GLMCVFQGYSSKGLVQRSLFNLQIYGVLGLFWTLNWVLALGQCVLAGAFASFYWAFHKPQ
DIPTFPLISAFIRTLRYHTGSLAFGALILTLVQIARVILEYIDHKLRGVQNPVTRCIMCC
FKCCLWCLEKFIKFLNRNAYIMIAIYGKNFCVSAKNAFTLLMRNIVRVVVLDKVTDLLLF
FGKLLVVGGVGVLSFFFFSGRIQGLGRDFKSPHLNYYWLPIMTSIMGAYVIASGFFSVFG
MCVDTLFLCFLEDLERNDGSLDRPYYMSKSLLKILGKKNEAPPDNKKRKK
NT seq 2133 nt   +upstreamnt  +downstreamnt
atggggggaaaacagcgggacaaggatgatgaagcctatgggaagccagtcaaatacgac
ccctcctttcgaggccccatcaagaacagaagctgtacagatgtcatctgctgcgtcctc
ttcctgctcttcattctaggttacatcgtggtggggattgtggcctggttgtatggagac
ccgcggcaagtcctctaccccaggaactctaccggggcctactgtggcatgggggaaaac
aaagataagccgtatctcctgtacttcaacatcttcagctgcatcctgtccaccaacatc
atctcagtggctgagaatggcttacagtgccccacgccccaggtgtgtgtgtcctcctgc
ccagaggccccatggactgtgggaaaaaaccagttctcgcagactgttggggaagtcttc
tatacaaaaaacaggaacttttgtctgccaggggtaccctggaatatgatggtgatcaca
agcctgcaacaggaactctgccccagtttcctcctcccctctgctccagctctggggcgc
tgcttcccatggaccaatgtcactctaccggagctcccagggatcaccaatgacaccacc
atagcgcaggggatcagtggtcttattgacagcctcaatgcccgagacatcagtgttaag
atctttgaagattttgcccactcctggtattggattcttgtagccctgggagtggctctg
gtcttgagcctactgtttatcttgcttctgcgcctggtggctgggcccctggtgctggtg
ctgatcctgggggtcctgggcgtgctggcatacggcatctactactgctgggaggagtac
cgagtgctgcgggacaagggcgcctccatctcccagctgggtttcaccaccaacctcagt
gcctaccagagcgtgcaggagacctggctggccgccctgatcgtgctggcggtgcttgaa
gccatcctgctgctggtgctcatcttcctgcggcagcggattcgtattgccatcgccctc
ctgaaggaggccagcaaggctgtgggacagatgatgtctaccatgttctacccgctggtc
acctttgtcctcctcctcatctgcattgcctactgggccatgactgctctgtacctggct
acatcagggcaaccccagtatgtgctctgggcatccaacatcagctcccccggctgtgag
aaagtgtcaataaatacatcatgcaaccccatggaccagcctgtgaactcctcgtgccca
gggctgatgtgcgtcttccagggctactcatccaaaggcctagtccaacgttctctcttc
aacctgcaaatctatggggtcctggggctcttctggacccttaactgggtactggccctg
ggccagtgcgtcctggccggagcctttgcctctttctactgggccttccacaagccccag
gatatccctaccttccccctaatctctgccttcatccgcacactccgttaccacactggg
tcgttggcatttggagccctcatcctgacccttgtgcagatagcccgggtcatcttggag
tatattgaccacaagctgagaggagtgcagaaccctgtaacccgctgcatcatgtgctgt
ttcaagtgctgcctctggtgtctggaaaaatttatcaagttcctaaaccgcaatgcatac
atcatgatcgccatctacgggaagaatttctgtgtctcagccaaaaatgccttcacacta
ctcatgcgaaacattgtcagggtggtcgtcctggataaagtcacagacctgctgctgttc
tttgggaagctgctggtggtcggaggcgttggggtcctgtccttcttttttttctccggt
cgcatccagggactgggtagagactttaagagcccccatctcaactattactggctgccc
atcatgacctccatcatgggggcctacgtcatcgccagcggcttcttcagcgttttcggc
atgtgtgtggatacgctcttcctctgcttccttgaagacctggagcggaacgacggctcc
ctggaccggccctactacatgtccaagagccttctaaagattctgggcaagaagaacgag
gctcccccggacaacaagaagaggaagaagtga

KEGG   Macaca mulatta (rhesus monkey): 715816
Entry
715816            CDS       T01028                                 

Gene name
SLC44A1
Definition
(RefSeq) choline transporter-like protein 1 isoform X4
  KO
K06515  solute carrier family 44 (choline transporter-like protein), member 1
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    715816 (SLC44A1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mcc02000]
    715816 (SLC44A1)
   04090 CD molecules [BR:mcc04090]
    715816 (SLC44A1)
Transporters [BR:mcc02000]
 Solute carrier family (SLC)
  SLC44: Choline-like transporter
   715816 (SLC44A1)
CD molecules [BR:mcc04090]
 Proteins
  715816 (SLC44A1)
SSDB
Motif
Pfam: Choline_transpo
Other DBs
NCBI-GeneID: 715816
NCBI-ProteinID: XP_014972639
Ensembl: ENSMMUG00000015024
LinkDB
Position
15
AA seq 657 aa
MGCCSSASSAAQSSKREWKPLEDRSCTDIPWLLLFILFCIGMGFICGFSIATGAAARLVS
GYDSYGNICGQKNTKLEAIPNSGMDHTQRKYVFFLDPCNLDLINRKIKSVALCVAACPRQ
ELKTLSDVQKFAEMNGSALCSYNLKPSEYTTSSKSSVLCPKLPVPASAPIPFFHRCAPVN
ISCYAKFAEALITFVSDNSVLHRLISGVMTSKEIILGLCLLSLVLSMILMVIIRYISRVL
VWILTILVILGSLGGTGVLWWLYAKQRRSPKETITPEQLQIAEDNLRALLIYAISATVFT
VILFLIMLVMRKRVALTIALFHVAGKVFIHLPLLVFQPFWTFFALVLFWAYWIMTLLFLG
TTGSPVQNEQGFVEFKISGPLQYMWWYHVVGLIWISEFILACQQMTVAGAVVTYYFTRDK
RNLPFTPILASVNRLIRYHLGTVAKGSFIITLVKIPRMILMYIHSQLKGKENACARCVLK
SCICCLWCLEKCLNYLNQNAYTATAINSTNFCTSAKDAFVILVENALRVATINTVGDFML
FLGKVLIVCSTGLAGIMLLNYQQDYTVWVLPLIIVCLFAFLVAHCFLSIYEMVVDVLFLC
FAIDTKYNDGSPGREFYMDKVLMEFVENSRKAMKEAGKGGVADARELKPMASGASSA
NT seq 1974 nt   +upstreamnt  +downstreamnt
atgggctgctgcagctccgcctcctccgccgcgcagagctccaaacgagaatggaagcca
ctggaggaccgtagctgcacagacataccatggctactgctcttcatcctcttctgcatt
gggatgggatttatttgtggcttttcaatagcaacaggtgcagcagcaagactagtgtca
ggatacgacagctatggaaatatctgtgggcagaaaaatacaaagttggaagcaatacca
aacagtggcatggaccacacccagcggaagtatgtattctttttggatccatgcaacctg
gacttgataaaccggaagattaagtctgtagcactgtgtgtagcagcatgtccaaggcaa
gaactgaaaactctgagtgatgttcagaagtttgcagagatgaatggttcagcactatgt
agctacaacctaaagccttctgaatacactacatcttcaaaatcttctgttctctgcccc
aaactaccagttccagcgagtgcacctattccattcttccatcgctgtgctcctgtgaac
atttcctgctatgccaagtttgcagaggccctgatcacctttgtcagtgacaatagtgtc
ttacacaggctgattagtggagtaatgaccagcaaagaaattatattgggactttgcttg
ttatcactagttctatcaatgattttgatggtgataatcaggtatatatcaagagtactt
gtgtggatcttaacaattctggtcatactcggttcacttgggggcacaggtgtactgtgg
tggctgtatgcaaagcaaagaaggtctcccaaagaaactattactcccgagcagcttcag
atagctgaagacaaccttcgggccctcctcatttatgccatttcagctacagtgttcaca
gtgatcttattcctgataatgttggttatgcgcaaacgtgttgctcttaccatcgccttg
ttccacgtagctggcaaggtcttcattcacttgccactgctagtcttccaacccttctgg
actttctttgctcttgtcttgttttgggcgtactggatcatgacacttctttttcttggc
actaccggcagtcctgttcagaatgagcaaggctttgtggagttcaaaatttctgggcct
ctgcagtacatgtggtggtaccatgtggtgggcctgatttggatcagtgaatttattctg
gcgtgtcagcagatgacagtggcaggagctgtggtaacatactattttactagggataaa
aggaatttgccatttacacctattttggcatcagtaaatcgccttattcgttaccacctt
ggtacggtggcaaaaggatcttttattatcacattagtcaaaattccgcgaatgatcctt
atgtatattcacagtcagctcaaaggaaaggaaaatgcttgtgcacgatgtgtgctgaaa
tcttgcatttgttgcctttggtgtcttgaaaagtgcctaaattatttaaatcagaatgca
tacacagccacagctatcaacagcaccaacttctgcacctcagcaaaggatgcctttgtc
attctggtggagaatgctttgcgagtggctaccatcaacacagtgggagattttatgtta
ttcctaggcaaggtgctgatagtctgcagcacaggtttagctgggattatgctgctcaac
taccagcaggactacacagtatgggtgctgcctctgatcatcgtctgcctctttgctttc
ctagtcgctcattgcttcctgtctatttacgaaatggtagtggatgtgttattcttgtgt
tttgccattgatacaaaatacaatgatgggagccctggcagagaattctatatggataaa
gtgctgatggagtttgtggaaaacagtaggaaagcaatgaaagaagctggtaagggaggc
gtcgctgatgccagagagctaaagccgatggcttcgggagcaagttctgcttga

KEGG   Macaca mulatta (rhesus monkey): 715866
Entry
715866            CDS       T01028                                 

Gene name
SLC44A2
Definition
(RefSeq) choline transporter-like protein 2 isoform X1
  KO
K15377  solute carrier family 44 (choline transporter-like protein), member 2/4/5
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    715866 (SLC44A2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mcc02000]
    715866 (SLC44A2)
   04147 Exosome [BR:mcc04147]
    715866 (SLC44A2)
Transporters [BR:mcc02000]
 Solute carrier family (SLC)
  SLC44: Choline-like transporter
   715866 (SLC44A2)
Exosome [BR:mcc04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   715866 (SLC44A2)
SSDB
Motif
Pfam: Choline_transpo
Other DBs
NCBI-GeneID: 715866
NCBI-ProteinID: XP_014978356
Ensembl: ENSMMUG00000003744
UniProt: F6RT54
LinkDB
Position
19
AA seq 711 aa
MGDERPHYYGKHGTPQKYDPTFKGPIYNRGCTDVICCVFLLLAIVGYVAVGIIAWTHGDP
RKVIYPTDSRGEFCGQKGTKNENKPYLFYFNIVKCASPLVLLEFQCPTPQICVEKCPDRY
LTYLNARSSRDFEYYKQFCVPGFKDNKGVAEVLRDGDCPAVLIPSKPLARRCFPAIHAHK
GVLMVGNETTYEDGHGSRKNITDLVEGAKKANGVLEARQLAMRIFEDYTVSWYWIIIGLV
IAMAMSLLFIILLRFLAGIMVWVMIIMVILVLGYGIFHCYMEYSRLRGEAGSDVSLVDLG
FQTDFRVYLHLRQTWLAFMIILSILEVIIILLLIFLRKRILIAIALIKEASRAVGYVMCS
LLYPLVTFFLLCLCIAYWASTAVFLSTSNEAVYKIFDDSSCSLTAKTCNPETFPSSNESR
LCPNARCQFAFYGGESGYHRALLGLQIFNAFMFFWLANFVLALGQVTLAGAFASYYWALR
KPDDLPAFPLFSAFGRALRYHTGSLAFGALILAIVQIIRVILEYLDQRLKAAENKFAKCL
MTCLKCCFWCLEKFIKFLNRNAYIMIAIYGTNFCTSARNAFFLLMRNIIRVAVLDKVTDF
LFLLGKLLIVGSVGILAFFFFTHRIRIVQDTAPPLNYYWVPILTVIVGSYLIAHGFFSVY
GMCVDTLFLCFCEDLERNDGSQERPYFMSPELRDILLKGSAEEGKRAEAEE
NT seq 2136 nt   +upstreamnt  +downstreamnt
atgggggacgagcggccccactactacgggaaacacggaacgccgcagaagtatgatccc
actttcaaaggacctatttacaataggggctgcacggacgtcatatgctgtgtattcctg
ctcctggccattgtgggctacgtggctgtgggcattatagcctggactcatggagaccct
cgaaaggtgatctaccctactgatagccggggcgagttctgtgggcagaagggcacaaaa
aacgagaacaaaccctacttgttttatttcaacattgtgaaatgtgccagccccctggtt
ctgctggaattccaatgtcccactcctcagatctgcgtggaaaaatgccccgaccgctac
ctcacgtacctgaatgctcgcagctcccgggactttgagtactataagcagttctgtgtt
cctggcttcaaggacaataaaggagtggctgaggtgcttcgagatggtgactgccctgct
gtcctcatccccagcaaacccttggcccggagatgcttccccgccatccacgcccacaag
ggtgtcctgatggtgggcaatgagacgacttatgaggatgggcatggctcccggaaaaac
atcacggacctggtggagggcgctaagaaagccaatggagtcctagaggcgcggcaactc
gccatgcgcatatttgaagattacaccgtctcttggtattggattatcataggtctggtc
attgctatggcaatgagcctcctattcatcatcctgctccgcttcctggctggcattatg
gtctgggtgatgatcattatggtgattctggtgctgggctacggaatctttcactgctac
atggagtactcccgactgcgtggtgaggctggctctgatgtctctttggtggacctcggc
tttcagacggatttccgggtgtacctgcacttacggcagacctggttggcctttatgatc
attctgagtatccttgaagtcattatcatcttgctgctcatctttctccggaagagaatt
ctcatcgcgattgcactcatcaaagaagccagcagggctgtgggatatgtcatgtgctcc
ttgctctacccactggtcaccttcttcttgctgtgcctctgcatcgcctactgggccagc
actgctgtcttcctgtccacttccaatgaagcggtctataagatctttgatgatagctcc
tgctcacttactgcgaaaacctgcaacccagagaccttcccctcctccaatgagtcccgc
ctatgccccaatgcccgttgccagttcgccttctacggtggtgagtcgggctaccaccgg
gccctgctgggcctgcagatcttcaatgccttcatgttcttctggttggccaacttcgtg
ctggctctgggccaggtcacactggccggggcctttgcctcctactactgggccctgcgc
aagccggacgacctgccggccttcccgctcttctctgcctttggccgggcgctcaggtac
cacacgggctccctggcctttggcgcgctcatcctggccattgtgcagatcattcgtgtg
atactcgagtacctggatcagcggctgaaagccgcagagaacaagtttgccaagtgcctc
atgacctgtctcaaatgctgcttctggtgcctggagaagttcatcaaattcctcaatagg
aatgcctacatcatgattgccatctacggcaccaatttctgcacctcggccaggaatgcc
ttcttcctgctcatgagaaacatcatcagagtggctgtcctggacaaagttaccgacttc
ctcttcctgttgggcaaacttttgatcgtaggcagtgtgggtatcctggctttcttcttc
ttcacccaccgtatcaggatcgtgcaggatacagcaccacccctcaattattactgggtt
cctatactgacggtgatcgttggctcctacctgattgcacatggtttcttcagcgtctat
ggcatgtgtgtggacacactgttcctctgcttctgtgaggacctggaaaggaatgacggc
tctcaggagcgaccctacttcatgtcgcccgagctgagagacatcctgttgaaggggagt
gcggaggaggggaagcgggcggaagccgaggagtag

DBGET integrated database retrieval system