KEGG   Macaca mulatta (rhesus monkey): 703628
Entry
703628            CDS       T01028                                 

Gene name
EIF4EBP1
Definition
(RefSeq) eukaryotic translation initiation factor 4E-binding protein 1
  KO
K07205  eukaryotic translation initiation factor 4E binding protein 1
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc01521  EGFR tyrosine kinase inhibitor resistance
mcc03013  RNA transport
mcc04012  ErbB signaling pathway
mcc04066  HIF-1 signaling pathway
mcc04150  mTOR signaling pathway
mcc04151  PI3K-Akt signaling pathway
mcc04152  AMPK signaling pathway
mcc04211  Longevity regulating pathway
mcc04218  Cellular senescence
mcc04910  Insulin signaling pathway
mcc05163  Human cytomegalovirus infection
mcc05165  Human papillomavirus infection
mcc05168  Herpes simplex virus 1 infection
mcc05221  Acute myeloid leukemia
mcc05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    703628 (EIF4EBP1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    703628 (EIF4EBP1)
   04066 HIF-1 signaling pathway
    703628 (EIF4EBP1)
   04151 PI3K-Akt signaling pathway
    703628 (EIF4EBP1)
   04152 AMPK signaling pathway
    703628 (EIF4EBP1)
   04150 mTOR signaling pathway
    703628 (EIF4EBP1)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    703628 (EIF4EBP1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    703628 (EIF4EBP1)
  09149 Aging
   04211 Longevity regulating pathway
    703628 (EIF4EBP1)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    703628 (EIF4EBP1)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    703628 (EIF4EBP1)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    703628 (EIF4EBP1)
   05163 Human cytomegalovirus infection
    703628 (EIF4EBP1)
   05165 Human papillomavirus infection
    703628 (EIF4EBP1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    703628 (EIF4EBP1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mcc03019]
    703628 (EIF4EBP1)
Messenger RNA biogenesis [BR:mcc03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     703628 (EIF4EBP1)
SSDB
Motif
Pfam: eIF_4EBP
Other DBs
NCBI-GeneID: 703628
NCBI-ProteinID: XP_015000653
Ensembl: ENSMMUG00000038480
UniProt: G7MZ42 A0A663DE11
LinkDB
Position
8
AA seq 118 aa
MSGGSSCSQTPSRAIPATRRVVLGDGVQLPPGDYSTTPGGTLFSTTPGGTRIIYDRKFLM
ECRNSPVTKTPPKDLPAIPGVTSPSSDEPPTEASQSHLRNSPEDKRAGGEESQFEMDI
NT seq 357 nt   +upstreamnt  +downstreamnt
atgtccgggggcagcagctgcagccagaccccaagtcgggccatccccgccactcgccgg
gtggtgctcggcgacggcgtgcagctcccgcccggggactacagcacgacccccggcggc
acactcttcagcaccaccccgggaggtaccaggatcatctatgaccggaaattcctgatg
gagtgtcggaactcacctgtgaccaaaacacccccgaaggatctgcctgccattcccggg
gtcaccagcccttccagtgatgagccccccacggaagccagccagagccacctgcgtaat
agcccagaagataagcgggcaggcggtgaagagtcacagtttgagatggacatttaa

DBGET integrated database retrieval system