KEGG   Macaca mulatta (rhesus monkey): 703669
Entry
703669            CDS       T01028                                 

Gene name
ITPR1
Definition
(RefSeq) inositol 1,4,5-trisphosphate receptor type 1 isoform X1
  KO
K04958  inositol 1,4,5-triphosphate receptor type 1
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04020  Calcium signaling pathway
mcc04022  cGMP-PKG signaling pathway
mcc04070  Phosphatidylinositol signaling system
mcc04114  Oocyte meiosis
mcc04140  Autophagy - animal
mcc04210  Apoptosis
mcc04218  Cellular senescence
mcc04270  Vascular smooth muscle contraction
mcc04371  Apelin signaling pathway
mcc04540  Gap junction
mcc04611  Platelet activation
mcc04621  NOD-like receptor signaling pathway
mcc04625  C-type lectin receptor signaling pathway
mcc04713  Circadian entrainment
mcc04720  Long-term potentiation
mcc04723  Retrograde endocannabinoid signaling
mcc04724  Glutamatergic synapse
mcc04725  Cholinergic synapse
mcc04726  Serotonergic synapse
mcc04728  Dopaminergic synapse
mcc04730  Long-term depression
mcc04750  Inflammatory mediator regulation of TRP channels
mcc04912  GnRH signaling pathway
mcc04915  Estrogen signaling pathway
mcc04918  Thyroid hormone synthesis
mcc04921  Oxytocin signaling pathway
mcc04922  Glucagon signaling pathway
mcc04924  Renin secretion
mcc04925  Aldosterone synthesis and secretion
mcc04927  Cortisol synthesis and secretion
mcc04928  Parathyroid hormone synthesis, secretion and action
mcc04929  GnRH secretion
mcc04934  Cushing syndrome
mcc04935  Growth hormone synthesis, secretion and action
mcc04970  Salivary secretion
mcc04971  Gastric acid secretion
mcc04972  Pancreatic secretion
mcc05010  Alzheimer disease
mcc05012  Parkinson disease
mcc05016  Huntington disease
mcc05017  Spinocerebellar ataxia
mcc05020  Prion disease
mcc05022  Pathways of neurodegeneration - multiple diseases
mcc05163  Human cytomegalovirus infection
mcc05167  Kaposi sarcoma-associated herpesvirus infection
mcc05170  Human immunodeficiency virus 1 infection
mcc05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    703669 (ITPR1)
   04020 Calcium signaling pathway
    703669 (ITPR1)
   04070 Phosphatidylinositol signaling system
    703669 (ITPR1)
   04022 cGMP-PKG signaling pathway
    703669 (ITPR1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    703669 (ITPR1)
  09143 Cell growth and death
   04114 Oocyte meiosis
    703669 (ITPR1)
   04210 Apoptosis
    703669 (ITPR1)
   04218 Cellular senescence
    703669 (ITPR1)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    703669 (ITPR1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    703669 (ITPR1)
   04621 NOD-like receptor signaling pathway
    703669 (ITPR1)
   04625 C-type lectin receptor signaling pathway
    703669 (ITPR1)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    703669 (ITPR1)
   04929 GnRH secretion
    703669 (ITPR1)
   04912 GnRH signaling pathway
    703669 (ITPR1)
   04915 Estrogen signaling pathway
    703669 (ITPR1)
   04921 Oxytocin signaling pathway
    703669 (ITPR1)
   04935 Growth hormone synthesis, secretion and action
    703669 (ITPR1)
   04918 Thyroid hormone synthesis
    703669 (ITPR1)
   04928 Parathyroid hormone synthesis, secretion and action
    703669 (ITPR1)
   04924 Renin secretion
    703669 (ITPR1)
   04925 Aldosterone synthesis and secretion
    703669 (ITPR1)
   04927 Cortisol synthesis and secretion
    703669 (ITPR1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    703669 (ITPR1)
  09154 Digestive system
   04970 Salivary secretion
    703669 (ITPR1)
   04971 Gastric acid secretion
    703669 (ITPR1)
   04972 Pancreatic secretion
    703669 (ITPR1)
  09156 Nervous system
   04724 Glutamatergic synapse
    703669 (ITPR1)
   04725 Cholinergic synapse
    703669 (ITPR1)
   04728 Dopaminergic synapse
    703669 (ITPR1)
   04726 Serotonergic synapse
    703669 (ITPR1)
   04720 Long-term potentiation
    703669 (ITPR1)
   04730 Long-term depression
    703669 (ITPR1)
   04723 Retrograde endocannabinoid signaling
    703669 (ITPR1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    703669 (ITPR1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    703669 (ITPR1)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    703669 (ITPR1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    703669 (ITPR1)
   05012 Parkinson disease
    703669 (ITPR1)
   05016 Huntington disease
    703669 (ITPR1)
   05017 Spinocerebellar ataxia
    703669 (ITPR1)
   05020 Prion disease
    703669 (ITPR1)
   05022 Pathways of neurodegeneration - multiple diseases
    703669 (ITPR1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    703669 (ITPR1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    703669 (ITPR1)
   05163 Human cytomegalovirus infection
    703669 (ITPR1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    703669 (ITPR1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mcc01009]
    703669 (ITPR1)
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mcc04040]
    703669 (ITPR1)
Protein phosphatases and associated proteins [BR:mcc01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     703669 (ITPR1)
Ion channels [BR:mcc04040]
 Ligand-gated channels
  IP3 receptor
   703669 (ITPR1)
SSDB
Motif
Pfam: Ins145_P3_rec RYDR_ITPR MIR RIH_assoc Ion_trans
Other DBs
NCBI-GeneID: 703669
NCBI-ProteinID: XP_014985841
Ensembl: ENSMMUG00000012574
LinkDB
Position
2
AA seq 2759 aa
MSDKMSSFLHIGDICSLYAEGSTNGFISTLGLVDDRCVVQPETGDLNNPPKKFRDCLFKL
CPMNRYSAQKQFWKAAKPGANSTTDAVLLNKLHHAADLEKKQNETENRKLLGTVIQYGNV
IQLLHLKSNKYLTVNKRLPALLEKNAMRVTLDEAGNEGSWFYIQPFYKLRSIGDSVVIGD
KVVLNPVNAGQPLHASSHQLVDNPGCNEVNSVNCNTSWKIVLFMKWSDNKDDILKGGDVV
RLFHAEQEKFLTCDEHRKKQHVFLRTTGRQSATSATSSKALWEVEVVQHDPCRGGAGYWN
SLFRFKHLATGHYLAAEVDPDFEEECLEFQPSVDPDQDASRSRLRNAQEKMVYSLVSVPE
GNDISSIFELDPTTLRGGDSLVPRNSYVRLRHLCTNTWVHSTNIPIDKEEEKPVMLKIGT
SPVKEDKEAFAIVPVSPAEVRDLDFANDASKVLGSIAGKLEKGTITQNERRSVTKLLEDL
VYFVTGGTNSGQDVLEVVFSKPNRERQKLMREQNILKQIFKLLQAPFTDCGDGPMLRLEE
LGDQRHAPFRHICRLCYRVLRHSQQDYRKNQEYIAKQFGFMQKQIGYDVLAEDTITALLH
NNRKLLEKHITAAEIDTFVSLVRKNREPRFLDYLSDLCVSMNKSIPVTQELICKAVLNPT
NADILIETKLVLSRFEFEGVSSTGENALEAGEDEEEVWLFWRDSNKEIRSKSVRELAQDA
KEGQKEDRDVLSYYRYQLNLFARMCLDRQYLAINEISGQLDVDLILRCMSDENLPYDLRA
SFCRLMLHMHVDRDPQEQVTPVKYARLWSEIPSEIAIDDYDSSGASKDEIKERFAQTMEF
VEEYLRDVVCQRFPFSDKEKNKLTFEVVNLARNLIYFGFYNFSDLLRLTKILLAILDCVH
VTTIFPISKMAKGEENKGNNDVEKLKSSNVMRSIHGVGELMTQVVLRGGGFLPMTPMAAA
PEGNVKQAEPEKEDIMVMDTKLKIIEILQFILNVRLDYRISCLLCIFKREFDESNSQTSE
TSSGNISQEGPSNVPGALDFEHIEEQAEGIFGGSEENTPLDLDDHGGRTFLRVLLHLTMH
DYPPLVSGALQLLFRHFSQRQEVLQAFKQVQLLVTSQDVDNYKQIKQDLDQLRSIVEKSE
LWVYKGQGPDETMDGASGENGHKKTEEGNNKSQKHESTSSYNYRVVKEILIRLSKLCVQE
SASVRKSRKQQQRLLRNMGAHAVVLELLQIPYEKAEDTKMQEIMRLAHEFLQNFCAGNQQ
NQALLHKHINLFLNPGILEAVTMQHIFMNNFQLCSEINERVVQHFVHCIETHGRNVQYIK
FLQTIVKAEGKFIKKCQDMVMAELVNSGEDVLVFYNDRASFQTLIQMMRSERDRMDENSP
LMYHIHLVELLAVCTEGKNVYTEIKCNSLLPLDDIVRVVTHEDCIPEVKIAYINFLNHCY
VDTEVEMKEIYTSNHMWKLFENFLVDICRACNNTSDRKHADSILEKYVTEIVMSIVTTFF
SSPFSDQSTTLQTRQPVFVQLLQGVFRVYHCNWLMPSQKASVESCIRVLSDVAKSRAIAI
PVDLDSQVNNLFLKSHNIVQKTAMNWRLSARNAARRDSVLAASRDYRNIIERLQDIVSAL
EDRLRPLVQAELSVLVDVLHRPELLFPENTDARRKCESGGFICKLIKHTKQLLEENEEKL
CIKVLQTLREMMTKDRGYGEKLISIDELDNAELPPAPDSENATEQELEPSPPLRQLEDHK
RGEALRQILVNRYYGNIRPSGRRESLTSFGNGPLSPGGPSKPGGGGGGSGSSSMSRGEMS
LAEVQCHLDKEGASNLVIDLIMNASSDRVFHESILLAIALLEGGNTTIQHSFFCRLTEDK
KSEKFFKVFYDRMKVAQQEIKATVTVNTSDLGNKKKDDEVDRDAPSRKKAKEPTTQITEE
VRDQLLEASAATRKAFTTFRREADPDDHYQPGEGTQATADKTKDDLEMSAVITIMQPILR
FLQLLCENHNRDLQNFLRCQNNKTNYNLVCETLQFLDCICGSTTGGLGLLGLYINEKNVA
LINQTLESLTEYCQGPCHENQNCIATHESNGIDIITALILNDINPLGKKRMDLVLELKNN
ASKLLLAIMESRHDSENAERILYNMRPKELVEVIKKAYMQGEVEFEDGENGEDGAASPRN
VGHNIYILAHQLARHNKELQSMLKPGGQVDGDEALEFYAKHTAQIEIVRLDRTMEQIVFP
VPSICEFLTKESKLRIYYTTERDEQGSKINDFFLRSEDLFNEMNWQKKLRAQPVLYWCAR
NMSFWSSISFNLAVLMNLLVAFFYPFKGVRGGTLEPHWSGLLWTAMLISLAIVIALPKPH
GIRALIASTILRLIFSVGLQPTLFLLGAFNVCNKIIFLMSFVGNCGTFTRGYRAMVLDVE
FLYHLLYLVICAMGLFVHEFFYSLLLFDLVYREETLLNVIKSVTRNGRSIILTAVLALIL
VYLFSIVGYLFFKDDFILEVDRLPNETAVPETGESLASEFLFSDVCRVESGENCSSPAPK
EELVPAEETEQDKEHTCETLLMCIVTVLSHGLRSGGGVGDVLRKPSKEEPLFAARVIYDL
LFFFMVIIIVLNLIFGVIIDTFADLRSEKQKKEEILKTTCFICGLERDKFDNKTVTFEEH
IKEEHNMWHYLCFIVLVKVKDSTEYTGPESYVAEMIKERNLDWFPRMRAMSLVSSDSEGE
QNELRNLQEKLESTMKLVTNLSGQLSELKDQMTEQRKQKQRIGLLGHPPHMNVNPQQPA
NT seq 8280 nt   +upstreamnt  +downstreamnt
atgtctgacaaaatgtctagcttcctgcatattggagacatttgttctctgtacgcggag
ggatcgacaaatggatttattagcaccttgggcctggttgatgatcgttgtgttgtacag
ccagaaaccggggaccttaacaatccacctaagaaattcagagactgcctctttaagcta
tgtcccatgaaccgctactctgcccagaagcagttctggaaagctgctaagcctggggcc
aacagcacaacagatgcagtgctgctcaacaaactacaccacgctgcagacttggaaaag
aagcagaatgagacagaaaacaggaaattgctggggaccgtaatccagtatggcaatgtg
atccagctcctgcatttgaaaagtaataaatacctaacagtgaataagaggcttcccgct
ctgttggagaagaacgccatgagagtcacattggatgaggctggaaatgaagggtcctgg
ttttacattcagccattctacaagctgcgatccattggagacagcgtggtcataggtgac
aaggttgttctgaaccccgtcaatgctggtcagcccctacatgctagcagccatcaactg
gtagataacccaggctgcaatgaggtcaactctgtcaactgcaatacaagctggaaaata
gtccttttcatgaaatggagtgataacaaagatgacatattaaaggggggtgacgtggtg
aggctgttccatgctgagcaggagaagtttctcacctgtgacgaacacaggaagaagcag
catgtctttctgagaaccacgggccggcagtcggccacatctgccactagttcaaaagcc
ctgtgggaggtagaggtggtccagcatgacccgtgtcggggcggagcagggtattggaac
agccttttccgcttcaagcacctggccacggggcattacttggcagcagaggtagaccct
gactttgaggaagaatgcctggagtttcagccctcagtagaccctgatcaggatgcctct
cgaagtaggttgcggaatgcccaagaaaagatggtgtactccctggtctctgtgcccgaa
ggcaatgacatctcctccatttttgagttagaccccaccactctccgtggaggcgacagc
cttgtcccaaggaactcttatgttcggctcagacacctatgtactaatacctgggttcac
agcacaaatattcctattgacaaggaagaagaaaagcccgtgatgctaaaaattggcacc
tctcctgtgaaggaggataaggaagcatttgccatagttcccgtttctcctgctgaagtt
cgggacctggactttgccaatgatgccagcaaggtgctgggctccattgctgggaagctg
gagaagggcaccatcacccagaatgaaaggaggtctgtaaccaagctgctggaagacttg
gtttactttgtcactggtggaactaattctggtcaagatgttcttgaagttgtcttctcc
aagcccaacagagaacggcagaaactgatgagagaacagaatattctcaagcagatcttc
aagttgttacaagccccattcacagactgcggtgatggcccaatgcttcggctggaagag
ctcggggaccagcggcacgctcctttcagacacatctgccggctctgctacagggtgctg
agacactcgcagcaagactacaggaagaaccaggagtatatagccaagcagtttggcttc
atgcagaagcagattggctatgatgtgttggccgaagacactatcactgccctgctccac
aataatcggaaactcctggaaaaacacattaccgcggcagagattgacacatttgtcagc
ctggtgcgaaagaacagggagcccagattcttagattacctctccgacctctgtgtttcc
atgaacaaatcgattccagtgacccaggagctaatatgtaaagctgtactgaatcccacc
aatgctgacatcctgattgagaccaagttggttctttctcgttttgagtttgaaggcgtt
tcttccactggagagaatgctctggaggcaggagaagacgaggaagaggtgtggctgttt
tggagggacagcaacaaagagattcgtagcaagagtgtgagggagttggcgcaggacgct
aaagaagggcagaaggaggaccgagacgttctcagctactacagatatcagctgaacctc
tttgccaggatgtgtctggaccgccaatacctggccatcaatgaaatctcaggccagctg
gatgtcgatctcattctccgctgcatgtctgacgagaacctgccctatgacctcagggca
tccttctgccgcctcatgcttcacatgcatgtggaccgagatccccaggaacaagtcacc
cccgtgaaatatgcccgcctctggtcagagattccctcggagattgccattgacgactat
gatagtagtggagcttccaaagatgaaattaaggagagatttgctcagaccatggagttt
gtggaggaatatttaagagatgtggtttgtcagcggttccctttctctgataaggagaaa
aataagcttacgtttgaggttgtaaatttagctaggaatctcatatactttggtttctac
aacttctctgaccttctacgattaactaagatccttctggccatattggactgtgtgcat
gtgacgacaatcttccccattagcaagatggcgaaaggagaagagaataaaggtaacaat
gatgtggagaagctgaagagcagtaacgtgatgaggtctattcatggcgtgggagagctg
atgacccaggtggtgctccggggaggaggctttttgcctatgactcccatggctgctgcc
cctgaaggcaatgtgaagcaggcagagcctgagaaggaggacatcatggtcatggacacc
aagctgaagatcattgagatactccagtttattttgaatgtgaggttggattataggatc
tcctgcctcctgtgtatatttaagcgagagtttgatgaaagcaattcccagacttcagaa
acatcctccggaaacatcagccaagaagggccaagtaatgtaccaggtgctcttgacttt
gaacacattgaagaacaagcagaaggcatctttggaggaagcgaggagaacaccccactg
gacttggacgatcacggcggcagaacctttctccgtgtcttgctccacctgacgatgcat
gactatccacccctggtgtcaggggccctgcagctcctcttccgacacttcagccagagg
caggaggtgctccaggccttcaaacaggttcaactgctggttaccagccaagatgtggac
aactacaaacagatcaaacaagacttggatcaactgaggtccatcgtggaaaagtcagag
ctttgggtgtacaaagggcagggccccgatgaaaccatggatggtgcatctggcgaaaat
ggacataagaaaacggaggagggaaataacaagtcacaaaagcatgaaagcaccagcagc
tacaactacagagtggtcaaagagattttgattcggctcagcaaactctgtgttcaggag
agtgcctcggtgagaaagagcaggaagcagcagcagcgtctgctccggaacatgggtgca
catgccgtggtgctggagctgctgcagattccctatgagaaggccgaagataccaagatg
caagagataatgaggctggctcatgaatttttgcagaatttctgtgcaggcaaccagcag
aatcaagctttgctacataaacacataaacctgtttctcaacccagggatcctggaggca
gtaaccatgcagcacatcttcatgaacaatttccagctttgcagtgagatcaacgagaga
gtcgttcagcacttcgttcactgcatagagactcacggtcggaacgtccagtatataaag
ttcttacagacaattgtcaaggcagaagggaaatttattaaaaaatgccaagacatggtt
atggctgagctggtcaattcaggagaggatgtcctcgtgttctacaacgacagagcctct
ttccagactctgatccagatgatgcggtcagagcgggatcggatggatgagaacagccct
ctcatgtaccacatccacttggtcgagcttctggctgtgtgcacggagggtaagaacgtc
tacacagagatcaagtgcaactccctgctcccgctggatgacatcgttcgcgtggtgacc
catgaggactgcatccctgaggttaaaattgcatacattaacttcctgaatcactgctat
gtggacacagaggtggaaatgaaggagatttacaccagcaatcacatgtggaaattgttt
gagaatttccttgtagacatctgcagggcctgtaacaacactagtgacaggaaacatgca
gactccattttggagaagtacgtcaccgaaatcgtcatgagtattgttactactttcttc
agctctcccttctcagaccagagtactactttgcagactcgccagcctgtctttgtgcaa
ctgctgcaaggagtgttcagagtttaccactgcaactggttaatgccaagccaaaaagcc
tccgtggagagctgtattcgggtgctgtctgatgtagccaagagccgggctattgccatt
cccgtggacctggacagccaagtcaacaacctctttctcaagtcccacaacattgtgcag
aaaacagccatgaactggcggctctcggcccgcaatgccgcacgcagggactctgttctg
gcagcttccagagactaccggaatatcattgagagattgcaggacatcgtctccgcgctg
gaggaccgtctcaggcccctggtgcaggcagagttatctgtgctcgtggatgttctccac
agacccgagctgcttttcccagagaacacagatgccagaaggaaatgtgaaagtggcggt
ttcatttgcaagttaataaagcatacaaaacagctgctagaagaaaatgaggagaagctc
tgcattaaggtcctccagaccctgagggaaatgatgaccaaagatagaggctatggagaa
aagctaatttccattgatgaattggataatgctgagcttcctcccgctccggattctgag
aacgccaccgagcaggagcttgaaccaagtccacccctgcggcagctggaagaccataaa
aggggtgaggcgctcaggcaaattctggtcaaccgttactatggaaacatcagaccttcg
ggaagaagagagagccttaccagctttggcaatggcccactgtcaccaggaggacccagc
aagcctgggggaggagggggaggttccggatccagctctatgagcaggggtgagatgagt
ctggccgaggttcagtgtcaccttgacaaggagggggcttccaatctagttatcgacctc
atcatgaacgcatccagtgaccgagtgttccatgaaagcattctcctggccattgccctt
ctggaaggaggcaacaccaccatccagcactcctttttctgccgtttgacagaagataag
aagtcagagaaattctttaaggtgttttatgaccggatgaaggtggcccagcaagaaatc
aaagcaacagtgacagtgaacaccagtgacttgggaaataaaaagaaagacgacgaggta
gacagagatgccccatcacggaaaaaagctaaagagcccacaacacagataacagaagag
gtccgggatcagctcctggaggcctctgctgccaccaggaaagccttcaccactttcagg
agggaggctgatcccgacgaccactaccagcctggagagggcacccaggccactgccgac
aagaccaaggacgacctggagatgagcgcggtcatcaccatcatgcagcccatcctccgc
ttcctgcaactcctgtgcgaaaaccacaaccgagacctgcagaacttcctccgttgccaa
aataacaagaccaactacaatttggtatgtgagacgctgcagtttctagactgtatttgt
ggaagcacaactggaggccttggtcttctgggcttgtatataaatgaaaagaacgtagca
cttatcaaccagaccctggaaagtctgaccgaatactgtcaaggaccttgccatgagaac
cagaactgcatagccactcatgaatccaatggcattgacatcatcacagccctgatcctc
aatgatatcaatcctttgggaaagaagaggatggaccttgtgttagaactgaagaacaat
gcctcgaagttactcctggccatcatggaaagcaggcacgacagtgaaaacgcagagagg
atactttataacatgaggcccaaggaactggtggaagtgatcaagaaagcctacatgcaa
ggtgaagtggaatttgaggatggagaaaacggtgaggatggagcggcgtcccccaggaac
gtggggcacaacatctacatattagctcatcagttggctcggcataacaaagaacttcag
agcatgctgaaacctggtggccaggtggatggagatgaagctctggagttttatgccaag
cacacggcgcagatagagattgtcagattagaccggacaatggaacagatagtctttcct
gtgcccagcatatgtgaattcctaaccaaggagtcgaaactgcgaatttactatactaca
gagagagacgaacaaggcagcaaaatcaacgatttctttctgcggtctgaagacctcttc
aatgaaatgaattggcagaagaaactgagagcccagcccgtgttgtactggtgtgcccgc
aacatgtctttctggagcagcatttcgtttaacctggccgtcctgatgaacctgctcgtg
gcgtttttctacccatttaagggagtccgaggaggaaccttggagccccactggtcgggc
ctcctgtggacagccatgctcatctctctggccatcgtcattgccctcccaaagccccat
ggcatccgggccttaattgcctccacaattctacgattgatattttcagtcgggttacaa
cccaccttgtttcttctgggcgctttcaatgtatgcaataaaatcatctttctaatgagc
tttgtgggcaactgtgggacgttcacaagaggctaccgagccatggttctggatgttgag
ttcctctatcatttgttgtatctggtgatctgtgccatggggctctttgtccatgaattc
ttctacagtctgctgctttttgatttagtgtacagagaagagactttgcttaatgtcatt
aaaagtgtcactcgcaatggacggtccatcatcctgacagcagttctggctctgatcctt
gtttacctgttctcaatagtgggctatcttttcttcaaggatgactttatcttggaagta
gataggctgcccaatgaaacagctgttccagaaaccggcgagagtttggcaagcgagttc
ctgttctccgatgtgtgtagggtggagagtggggagaactgctcctctcctgcacccaaa
gaagagctggtccctgcagaagaaacggaacaggataaagagcacacatgtgagacgctg
ctgatgtgcattgtcactgtactgagtcacgggctgcggagcgggggtggagtaggagat
gtgctcaggaagccgtccaaagaggaacccctgtttgctgctagagtgatttatgatctc
ttgttcttcttcatggttatcatcattgttcttaacctgatttttggggttatcattgac
acttttgctgacctgaggagtgagaaacagaagaaggaagagatcttgaagaccacgtgc
tttatctgtggcttggaaagagacaagtttgacaacaagactgttacctttgaagaacac
atcaaggaagaacacaacatgtggcactatctgtgcttcatcgtcctggtgaaagtaaag
gactccaccgaatatactgggcctgagagttatgtggcagaaatgatcaaggaaagaaac
cttgactggttccccaggatgagagccatgtcattggtcagcagtgattctgaaggagaa
cagaatgagctgaggaacctgcaggagaagctggagtccaccatgaaacttgtcacgaac
ctttctggccagctgtcagaattaaaggatcagatgacagaacaaaggaagcagaaacaa
agaattggtcttctaggacatcctcctcacatgaatgtcaacccacaacaaccagcctaa

KEGG   Macaca mulatta (rhesus monkey): 708714
Entry
708714            CDS       T01028                                 

Gene name
ITPR2
Definition
(RefSeq) inositol 1,4,5-trisphosphate receptor type 2 isoform X1
  KO
K04959  inositol 1,4,5-triphosphate receptor type 2
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04020  Calcium signaling pathway
mcc04022  cGMP-PKG signaling pathway
mcc04070  Phosphatidylinositol signaling system
mcc04114  Oocyte meiosis
mcc04210  Apoptosis
mcc04218  Cellular senescence
mcc04270  Vascular smooth muscle contraction
mcc04371  Apelin signaling pathway
mcc04540  Gap junction
mcc04611  Platelet activation
mcc04621  NOD-like receptor signaling pathway
mcc04625  C-type lectin receptor signaling pathway
mcc04720  Long-term potentiation
mcc04723  Retrograde endocannabinoid signaling
mcc04724  Glutamatergic synapse
mcc04725  Cholinergic synapse
mcc04726  Serotonergic synapse
mcc04728  Dopaminergic synapse
mcc04730  Long-term depression
mcc04750  Inflammatory mediator regulation of TRP channels
mcc04912  GnRH signaling pathway
mcc04915  Estrogen signaling pathway
mcc04918  Thyroid hormone synthesis
mcc04921  Oxytocin signaling pathway
mcc04922  Glucagon signaling pathway
mcc04924  Renin secretion
mcc04925  Aldosterone synthesis and secretion
mcc04927  Cortisol synthesis and secretion
mcc04928  Parathyroid hormone synthesis, secretion and action
mcc04929  GnRH secretion
mcc04934  Cushing syndrome
mcc04935  Growth hormone synthesis, secretion and action
mcc04970  Salivary secretion
mcc04971  Gastric acid secretion
mcc04972  Pancreatic secretion
mcc05010  Alzheimer disease
mcc05012  Parkinson disease
mcc05017  Spinocerebellar ataxia
mcc05020  Prion disease
mcc05022  Pathways of neurodegeneration - multiple diseases
mcc05163  Human cytomegalovirus infection
mcc05167  Kaposi sarcoma-associated herpesvirus infection
mcc05170  Human immunodeficiency virus 1 infection
mcc05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    708714 (ITPR2)
   04020 Calcium signaling pathway
    708714 (ITPR2)
   04070 Phosphatidylinositol signaling system
    708714 (ITPR2)
   04022 cGMP-PKG signaling pathway
    708714 (ITPR2)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    708714 (ITPR2)
   04210 Apoptosis
    708714 (ITPR2)
   04218 Cellular senescence
    708714 (ITPR2)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    708714 (ITPR2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    708714 (ITPR2)
   04621 NOD-like receptor signaling pathway
    708714 (ITPR2)
   04625 C-type lectin receptor signaling pathway
    708714 (ITPR2)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    708714 (ITPR2)
   04929 GnRH secretion
    708714 (ITPR2)
   04912 GnRH signaling pathway
    708714 (ITPR2)
   04915 Estrogen signaling pathway
    708714 (ITPR2)
   04921 Oxytocin signaling pathway
    708714 (ITPR2)
   04935 Growth hormone synthesis, secretion and action
    708714 (ITPR2)
   04918 Thyroid hormone synthesis
    708714 (ITPR2)
   04928 Parathyroid hormone synthesis, secretion and action
    708714 (ITPR2)
   04924 Renin secretion
    708714 (ITPR2)
   04925 Aldosterone synthesis and secretion
    708714 (ITPR2)
   04927 Cortisol synthesis and secretion
    708714 (ITPR2)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    708714 (ITPR2)
  09154 Digestive system
   04970 Salivary secretion
    708714 (ITPR2)
   04971 Gastric acid secretion
    708714 (ITPR2)
   04972 Pancreatic secretion
    708714 (ITPR2)
  09156 Nervous system
   04724 Glutamatergic synapse
    708714 (ITPR2)
   04725 Cholinergic synapse
    708714 (ITPR2)
   04728 Dopaminergic synapse
    708714 (ITPR2)
   04726 Serotonergic synapse
    708714 (ITPR2)
   04720 Long-term potentiation
    708714 (ITPR2)
   04730 Long-term depression
    708714 (ITPR2)
   04723 Retrograde endocannabinoid signaling
    708714 (ITPR2)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    708714 (ITPR2)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    708714 (ITPR2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    708714 (ITPR2)
   05012 Parkinson disease
    708714 (ITPR2)
   05017 Spinocerebellar ataxia
    708714 (ITPR2)
   05020 Prion disease
    708714 (ITPR2)
   05022 Pathways of neurodegeneration - multiple diseases
    708714 (ITPR2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    708714 (ITPR2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    708714 (ITPR2)
   05163 Human cytomegalovirus infection
    708714 (ITPR2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    708714 (ITPR2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mcc04040]
    708714 (ITPR2)
Ion channels [BR:mcc04040]
 Ligand-gated channels
  IP3 receptor
   708714 (ITPR2)
SSDB
Motif
Pfam: Ins145_P3_rec RYDR_ITPR MIR RIH_assoc Ion_trans Sec2p DUF2207
Other DBs
NCBI-GeneID: 708714
NCBI-ProteinID: XP_015006808
Ensembl: ENSMMUG00000023128
LinkDB
Position
11
AA seq 2703 aa
MTDKMSSFLYIGDIVSLYAEGSVNGFISTLGLVDDRCVVHPEAGDLANPPKKFRDCLFKV
CPMNRYSAQKQYWKAKQAKQGNHTEAALLKKLQHAAELEQKQNESENKKLLGEIVKYSNV
IQLLHIKSNKYLTVNKRLPALLEKNAMRVSLDAAGNEGSWFYIHPFWKLRSEGDNIVVGD
KVVLMPVNAGQPLHASNIELLDNPGCKEVNAVNCNTSWKITLFMKYSSYREDVLKGGDVV
RLFHAEQEKFLTCDEYEKKQHIFLRTTLRQSATSATSSKALWEIEVVHHDPCRGGAGQWN
SLFRFKHLATGNYLAAELNPDYRDAQNEGKNVRDDHPTSKKKRQAGEKIMYTLVSVPHGN
DIASLFELDATTLQRADCLVPRNSYVRLRHLCTNTWVTSTSIPIDTDEERPVMLKIGTCQ
TKEDKEAFAIVSVPLSEVRDLDFANDANKVLATTVKKLENGTITQNERRFVTKLLEDLIF
FVADVPNNGQEVLDVVITKPNRERQKLMREQNILAQVFGILKAPFKEKAGEGSMLRLEDL
GDQRYAPYKYMLRLCYRVLRHSQQDYRKNQEYIAKNFCVMQSQIGYDILAEDTITALLHN
NRKLLEKHITAKEIETFVSLLRRNREPRFLDYLSDLCVSNTTAIPVTQELICKFMLSPGN
ADILIQTKVVSMQADNPMESSILSDDIDDEEVWLYWIDSNREPHGKAIRHLAQEAKEGTK
ADLEVLTYYRYQLNLFARMCLDRQYLAINQISTQLSVDLILRCVSDESLPFDLRASFCRL
MLHMHVDRDPQESVVPVRYARLWTEIPTKITIHEYDSITDSSRNDMKRKFALTMEFVEEY
LKEVVNQPFPFGDKEKNKLTFEVVHLARNLIYFGFYSFSELLRLTRTLLAILDIVQAPMS
SYFERLSKFQDGGNNVMRTIHGVGEMMTQMVLSRGSIFPMSVPDVPPSIHPSKQGSPAEH
EDVTVMDTKLKIIEILQFILSVRLDYRISYMLSIYKKEFGEDNDNAETSASGSPDTLLPS
AIVPDIDEIAAQAETMFAGRKEKNPVQLDDEGGRTFLRVLIHLIMHDYPPLLSGALQLLF
KHFSQRAEVLQAFKQVQLLVSNQDVDNYKQIKADLDQLRLTVEKSELWVEKSSNYENGEI
GESQVKGGEEPIEESNILSPVQDGTKKPQIDSNKSNNYRIVKEILIRLSKLCVQNKKCRI
QHQRLLKNMGAHSVVLDLLQIPYEKNDEKMNEVMNLAHTFLQNFCRGNPQNQVLLHKHLN
LFLTPGLLEAETMRHIFMNNYHLCNEISERVVQHFVHCIETHGRHVEYLRFLQTIVKADG
KYVKKCQDMVMTELINGGEDVLIFYNDRASFPILLHMMCSERDRGDESGPLAYHITLVEL
LAACTEGKNVYTEIKCNSLLPLDDIVRVVTHDDCIPEVKIAYVNFVNHCYVDTEVEMKEI
YTSNHIWKLFENFLVDMARVCNTTTDRKHADIFLEKCVTESIMNIVSGFFNSPFSDNSTS
LQTHQPVFIQLLQSAFRIYNCTWPNPSQKASVESCIRTLAEVAKNRGIAIPVDLDGQVNT
LFMKSHSNMVQRAAMGWRLSARSGPRFKEALGGPSWDYRNIIEKLQDVVASLEHQFSPMM
QAEFSVLVDVLYSPELLFPEGSDARIRCGAFMSKLINHTKKLMEKEEKLCIKILQTLREM
LEKKDSFVEEGNTLRKILLNRYFKGDYSIGMNGHLSGAYSKTAQVGGSFSGQDSDKMGIS
MSDIQCLLDKEGASELVIDVIVNTKNDRIFSEGIFLGIALLEGGNTQTQYSFYQQLHEQK
KSEKFFKVLYDRMKAAQKEIRSTVTVNTIDLGSKKRDDDNELMTSGPRMRVRDSTLHLKE
GMKGQLTEASSATSKAYCVYRREMDPEIDIMCTGPEAGNTEEKSAEEVTMSPAIAIMQPI
LRFLQLLCENHNRELQNFLRNQNNKTNYNLVCETLQFLDCICGSTTGGLGLLGLYINEKN
VALVNQTLESLTEYCQGPCHENQTCIATHESNGIDIIIALILNDINPLGKYRMDLVLQLK
NNASKLLLAIMESRHDSENAERILFNMRPRELVDVMKNAYNQGLECDHGDDEGGDDGVSP
KDVGHNIYILAHQLARHNKLLQQMLKPGSDPDEGDEALKYYANHTAQIEIVRHDRTMEQI
VFPVPNICEYLTRESKCRVFNTTERDEQGSKVNDFFQQTEDLYNEMKWQKKIRNNPALFW
FSRHISLWGSISFNLAVFINLAVALFYPFGDDGDEGTLSPLFSVLLWIAVAICTSMLFFF
SKPVGIRPFLVSIMLRSIYTIGLGPTLILLGAANLCNKIVFLVSFVGNRGTFTRGYRAVI
LDMAFLYHVAYVLVCMLGLFVHEFFYSFLLFDLVYREETLLNVIKSVTRNGRSIILTAVL
ALILVYLFSIIGFLFLKDDFTMEVDRLKNRTPVTGSHQVPTMTLTTMMEACAKENCSPTI
PASNTADEEYEDGIERTCDTLLMCIVTVLNQGLRNGGGVGDVLRRPSKDEPLFAARVVYD
LLFYFIVIIIVLNLIFGVIIDTFADLRSEKQKKEEILKTTCFICGLERDKFDNKTVSFEE
HIKSEHNMWHYLYFIVLVKVKDPTEYTGPESYVAQMIVRKKEKNLDWFPRMRAMSLVSNE
GDSEQNEIRNLQEKLESTMSLVKQLSGQLAELKEQMTEQRKNKQRLGFLGSNTPHVNHHM
PPH
NT seq 8112 nt   +upstreamnt  +downstreamnt
atgactgataaaatgtccagcttcctctacataggggacatcgtgtccctgtacgcggag
ggctcggtcaacggcttcatcagcaccttggggttagtggatgacagatgtgtggtgcac
ccagaggccggggaccttgccaaccctcccaagaagttcagagactgccttttcaaggtg
tgccctatgaaccgatattctgcccagaagcaatattggaaagccaagcaagccaaacaa
gggaaccacaccgaggcagccttgctgaagaaactacagcacgctgcagaactggaacaa
aaacaaaatgaatcagagaataagaagctgttgggagaaattgtgaaatacagtaatgtt
atacaactactgcatataaaaagcaacaaatatcttactgtcaacaagagattgcctgct
ttactggagaagaatgccatgcgtgtgtccttggatgctgcgggaaacgaagggtcttgg
ttttatattcatcccttctggaagctgagaagcgagggtgacaatattgttgtaggagat
aaagttgttttgatgcctgtgaatgcaggacagccactacatgccagcaacatagagctt
cttgataacccagggtgtaaagaggtgaatgctgttaattgcaacaccagctggaaaatc
actttattcatgaaatatagttcctatcgagaggatgtattaaaaggaggggacgttgtt
agattgtttcatgcggaacaagagaagtttttgacttgtgatgaatacgagaaaaaacag
cacattttccttcgtacaaccttgcgccaatcagctacttctgctactagttctaaagcg
ctgtgggaaatagaggtggttcatcatgacccatgccgtgggggtgcaggacagtggaac
agcttgttcagatttaaacatcttgcaactggaaactatttagctgcagagcttaatcct
gattatcgagatgcccaaaatgaaggaaaaaatgtgagagatgaccatccaacttcaaag
aaaaaacgccaggcaggggagaagatcatgtatactttggtttcagtcccacatggcaat
gacattgcatccctttttgaactcgatgccacaactcttcagagagctgactgcctggtt
ccaaggaactcatatgttcggttaaggcatttatgcaccaacacatgggtaaccagtact
agtatccccatagacacagatgaagagaggcctgttatgttaaagattggaacctgccaa
accaaagaagataaagaagcgttcgccatcgtgtctgtcccactgtctgaagttcgagac
ttagactttgccaatgatgccaataaagtactagcgaccacagttaaaaagctagaaaat
ggcacaataactcagaatgaaaggaggtttgtaaccaaattattggaagacctcatcttc
tttgttgctgatgtgcctaataatggacaagaagttctggatgtggttatcactaagcca
aaccgagagcgtcaaaaattgatgagggaacaaaacatactggcgcaggtatttggaatt
cttaaagcaccctttaaagagaaagcaggagaaggctcaatgctgcgacttgaagatctt
ggggatcaaagatatgcaccctacaagtacatgctgcggctctgttaccgtgtcctgaga
cactctcagcaggattaccggaaaaatcaggaatatattgctaagaatttctgtgtcatg
cagtcccagattggctatgatattttggcagaagatactatcacagctttgttgcacaac
aacagaaaactactagagaaacatatcacagcaaaagaaatagaaacatttgtcagttta
ctcaggagaaatcgggagccaaggtttttggattatttgtcagatctgtgtgtgtctaat
accactgctattcctgtaactcaagaactcatctgtaaatttatgttgagtccaggcaat
gcagacattctcattcaaactaaggtggtctcaatgcaagcagacaaccccatggagagc
tccatcctttccgatgacattgacgatgaagaagtttggctctattggattgacagcaac
agggaacctcatggcaaagctatcaggcaccttgctcaagaggcaaaagaaggcaccaaa
gctgacttagaagttcttacctattacaggtaccagctaaacctctttgcaaggatgtgc
ttggatcgccagtatctggccataaaccagatttctacacagctctctgtagacctgatc
ctgcggtgtgtgtcggatgagagcctgccgttcgacctccgagcgtccttctgtcgcctc
atgctccacatgcacgttgaccgggatccccaggagtctgtggtgcctgttcgctatgcc
aggctctggacagaaatccccacaaagatcacaattcatgaatatgattctataacagac
tcttcccgaaatgatatgaagaggaaatttgccctgacaatggaatttgttgaagaatat
ttgaaagaagtcgtaaaccagccctttccttttggggataaagaaaaaaataaactgaca
tttgaggtggtccacttggctcggaatcttatatactttggattttatagtttcagtgag
ttattaaggctaacaagaacacttctggctattttagacattgtacaggctcccatgtcg
tcatactttgaaagattaagcaaatttcaagatggaggaaacaatgtgatgagaaccatt
catggggtgggagagatgatgacccagatggtactcagtagaggctccatcttccccatg
agcgtgccagatgtgccacccagcatccacccgagcaagcaagggagccccgccgagcat
gaggatgtgactgtgatggacaccaagctgaagatcattgagattttgcagtttatcctg
agtgtcagactagattataggatctcatatatgctgtcgatatataagaaggagtttgga
gaggacaatgacaatgcggagacatctgccagtggatctccagatactttactaccatca
gctattgttcctgatatagatgaaattgcagctcaggcagaaactatgtttgcgggaaga
aaggaaaaaaacccagttcaacttgatgatgaaggaggcaggacatttttacgggtcctc
attcatctgatcatgcacgactacccgcctttgctgtctggagccctgcagctgttgttt
aagcacttcagccagagggcggaggttttacaggcatttaagcaggtgcaattactggtg
tctaatcaagatgtagataactacaagcaaatcaaggcagatctagaccagcttcgactg
acagtggagaagtctgagctatgggttgagaagagcagcaactatgagaacggagaaata
ggggaaagtcaagtgaaaggcggtgaagagccaattgaggaatcgaacattttaagtcca
gtgcaggatggaacaaagaaacctcagattgacagcaacaagagcaataactaccggatt
gtaaaggagattttgattaggctaagtaaactctgtgtacagaataaaaagtgtcggatt
caacatcaacgattactgaaaaatatgggggcacattcagtggtgctagatcttctccag
ataccctacgaaaagaatgatgaaaaaatgaacgaagtaatgaatctagcccatacgttt
ctgcagaatttctgtcgaggaaatccacagaatcaagttcttcttcataaacatctgaat
ttgtttttaactccaggtctccttgaagcagaaaccatgcggcacatcttcatgaacaat
taccatctgtgcaacgaaattagcgagagagttgtacagcactttgtgcactgcattgag
acacatggccgccacgtggagtacctgaggtttttgcaaacaattgtgaaagcagatggt
aaatatgtgaagaaatgccaggatatggtaatgacagagttgataaatgggggtgaagac
gtgctgatattttacaatgatagagcgtcatttcccatccttctccatatgatgtgttca
gagagagaccgaggggatgagagtggccccttagcctaccacatcaccctggtggagctg
ctggcagcatgcacagaggggaaaaatgtctacactgaaatcaagtgtaattcccttctc
ccgctggacgacatagtgagggtggtgacccatgacgactgcatccctgaggttaaaatt
gcttatgtgaactttgttaatcactgttatgttgacactgaagtggaaatgaaagaaatc
tatacaagtaaccacatttggaaattatttgagaacttcttggtggatatggcaagggtt
tgcaacacaactacagacaggaaacatgcagacatctttttggaaaagtgtgttactgag
tcaataatgaatattgtgagcggcttctttaattcccccttttcagacaatagtaccagc
ctccagacacatcagccagtttttattcagctactgcaatctgccttcagaatttacaat
tgcacctggccaaacccgtcacagaaagcctcggtggaatcctgtatcagaactttggct
gaagtggcaaaaaatcgtggaattgccattccagtggatttggacggccaagttaatact
cttttcatgaagagccattcaaatatggtgcagagagcagcaatgggttggagactatca
gctcgctctgggccacgctttaaggaagctcttggagggccttcttgggattacagaaat
attattgaaaagttacaggatgtagtggcctccttggagcaccagttcagcccaatgatg
caggctgaattctcagtgttggttgatgtattgtacagtccagagctgctgttccctgag
ggaagcgatgcaagaataagatgtggcgctttcatgtcaaagttgattaatcatacaaag
aaactaatggagaaagaagaaaaactgtgcattaaaattcttcagacattacgagaaatg
ttagagaagaaagacagctttgtggaagagggtaacacattaagaaagatacttctgaat
cgatactttaaaggtgattatagtattggcatgaatggacacctatcaggagcctactcc
aaaactgcacaggtgggaggaagcttttctggacaagattcagataagatggggatatca
atgtcagatattcagtgtctgctggataaagaaggtgcctcagaacttgtcatcgatgtt
atagtgaacaccaaaaatgacagaattttttcagaaggcattttcctcggcattgccttg
ctcgaaggaggaaatacacaaacacagtattctttctaccagcagttgcatgaacaaaaa
aagtcagaaaaattctttaaagttctctatgatcgaatgaaggctgctcagaaagaaata
agatcaacagtgacagttaataccatagatttaggtagcaaaaaaagggatgatgacaat
gaattgatgacatctggtccacgaatgagagtaagagattcaacactacatttaaaagag
ggaatgaaagggcaattaacagaagcttcttcagcaacatccaaagcatattgtgtatac
agaagagaaatggatccagaaatagacattatgtgcacaggaccagaagcaggaaacact
gaggaaaaatctgcagaggaagtaacaatgagtcctgcaattgccatcatgcagccaata
ctgagatttcttcagttactgtgtgagaatcacaaccgggaattacagaacttcttgagg
aatcaaaacaacaaaacaaattacaaccttgtctgtgagacccttcagtttctggactgc
atttgcggaagtacaaccggtggcctgggcctgttgggtctctacatcaatgagaagaac
gtagcactggtcaaccagaccctggagagcttgactgagtattgccagggcccctgccat
gaaaatcagacctgtatcgctacacatgagtctaatgggattgatatcatcattgctttg
attctgaatgacataaaccctcttggtaaataccgaatggatctggtgctccagctaaag
aacaatgcatctaaacttttgctggccattatggaaagcagacatgacagcgagaatgca
gaaagaattctttttaacatgagacccagagaactggtggatgtgatgaagaatgcctac
aaccaaggattggaatgtgaccatggggatgacgagggtggagatgatggtgtttctcca
aaagatgttggacacaatatctatattctggcccatcagttggcccgccacaataaactg
ttgcagcagatgctcaaaccaggatcggatccagatgaaggagatgaagccttaaagtat
tatgccaaccacactgcacagattgagattgtccggcatgataggaccatggaacaaata
gtttttcctgtccccaatatatgtgaatacctcactcgagaatccaagtgccgtgtgttc
aatacaactgaaagggatgaacaaggaagtaaagtgaatgactttttccagcaaacagaa
gatctctacaatgaaatgaagtggcaaaagaaaatcagaaataaccctgcactgttctgg
ttctcgaggcacatctctctctgggggagcatttccttcaacctggctgtgttcatcaat
ttagctgttgctctcttctacccattcggggatgatggagatgaaggtacactttctcca
ttgttctcggttcttctttggatagcagttgcaatctgcacatctatgctgtttttcttc
tccaagcctgtgggtattcggccgtttcttgtatcaataatgctcagatcaatatacaca
ataggtcttgggcctaccttgatacttcttggtgcagctaatctttgtaataaaattgta
tttctggtgagttttgttggaaatcgtggcacgttcacccgtgggtaccgagcagtcatc
ctggatatggcctttctctatcacgtggcgtatgtcctggtttgcatgctgggccttttt
gtccatgaattcttctatagcttcctgctttttgatttggtgtacagagaagagactctg
ctgaatgtcataaaaagtgtcacacgaaatggccgctctattattctaactgcagtcctg
gctctcatcctcgtctacctgttttccattattgggttcctttttttgaaggatgacttc
actatggaagttgataggctgaaaaaccgaactcctgttacaggcagtcatcaagtgcct
accatgactttaactaccatgatggaagcatgtgccaaggagaactgttcacccacaatt
ccagcttcaaatacagctgatgaagagtatgaagatggaattgaaaggacgtgtgacact
ctccttatgtgcattgtcaccgtgctgaaccagggcctcaggaacggtggtggtgtgggg
gatgtgctaagaaggccatcaaaagatgagcccttgtttgctgcccgagtggtttatgac
cttcttttttatttcattgttatcattattgttctgaacttgatttttggtgttatcatc
gacacttttgctgatctcagaagtgaaaaacagaaaaaagaagaaattctaaagacaact
tgtttcatctgtggacttgagagagacaagtttgataataaaacggtttcatttgaggag
cacattaagtcagaacacaatatgtggcattatttgtacttcatagtcctggtgaaagtt
aaagacccaacagaatacactggacctgaaagttacgtggctcaaatgattgtgaggaaa
aaggagaagaatttggattggtttcctcggatgcgagccatgtccctcgttagcaatgaa
ggcgacagtgagcaaaatgaaattcggaaccttcaggagaagttggaatcgaccatgagt
ctagtcaaacagctgtcgggtcagctggcagagctcaaggagcagatgacagaacaaagg
aagaataagcagagactgggcttcctcggatcaaacacaccccatgtgaatcatcacatg
ccaccacactga

KEGG   Macaca mulatta (rhesus monkey): 718040
Entry
718040            CDS       T01028                                 

Gene name
ITPR3
Definition
(RefSeq) inositol 1,4,5-trisphosphate receptor type 3 isoform X1
  KO
K04960  inositol 1,4,5-triphosphate receptor type 3
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04020  Calcium signaling pathway
mcc04022  cGMP-PKG signaling pathway
mcc04070  Phosphatidylinositol signaling system
mcc04114  Oocyte meiosis
mcc04210  Apoptosis
mcc04218  Cellular senescence
mcc04270  Vascular smooth muscle contraction
mcc04371  Apelin signaling pathway
mcc04540  Gap junction
mcc04611  Platelet activation
mcc04621  NOD-like receptor signaling pathway
mcc04625  C-type lectin receptor signaling pathway
mcc04713  Circadian entrainment
mcc04720  Long-term potentiation
mcc04723  Retrograde endocannabinoid signaling
mcc04724  Glutamatergic synapse
mcc04725  Cholinergic synapse
mcc04726  Serotonergic synapse
mcc04728  Dopaminergic synapse
mcc04730  Long-term depression
mcc04742  Taste transduction
mcc04750  Inflammatory mediator regulation of TRP channels
mcc04911  Insulin secretion
mcc04912  GnRH signaling pathway
mcc04915  Estrogen signaling pathway
mcc04918  Thyroid hormone synthesis
mcc04921  Oxytocin signaling pathway
mcc04922  Glucagon signaling pathway
mcc04924  Renin secretion
mcc04925  Aldosterone synthesis and secretion
mcc04927  Cortisol synthesis and secretion
mcc04928  Parathyroid hormone synthesis, secretion and action
mcc04929  GnRH secretion
mcc04934  Cushing syndrome
mcc04935  Growth hormone synthesis, secretion and action
mcc04970  Salivary secretion
mcc04971  Gastric acid secretion
mcc04972  Pancreatic secretion
mcc05010  Alzheimer disease
mcc05012  Parkinson disease
mcc05014  Amyotrophic lateral sclerosis
mcc05017  Spinocerebellar ataxia
mcc05020  Prion disease
mcc05022  Pathways of neurodegeneration - multiple diseases
mcc05163  Human cytomegalovirus infection
mcc05167  Kaposi sarcoma-associated herpesvirus infection
mcc05170  Human immunodeficiency virus 1 infection
mcc05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    718040 (ITPR3)
   04020 Calcium signaling pathway
    718040 (ITPR3)
   04070 Phosphatidylinositol signaling system
    718040 (ITPR3)
   04022 cGMP-PKG signaling pathway
    718040 (ITPR3)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    718040 (ITPR3)
   04210 Apoptosis
    718040 (ITPR3)
   04218 Cellular senescence
    718040 (ITPR3)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    718040 (ITPR3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    718040 (ITPR3)
   04621 NOD-like receptor signaling pathway
    718040 (ITPR3)
   04625 C-type lectin receptor signaling pathway
    718040 (ITPR3)
  09152 Endocrine system
   04911 Insulin secretion
    718040 (ITPR3)
   04922 Glucagon signaling pathway
    718040 (ITPR3)
   04929 GnRH secretion
    718040 (ITPR3)
   04912 GnRH signaling pathway
    718040 (ITPR3)
   04915 Estrogen signaling pathway
    718040 (ITPR3)
   04921 Oxytocin signaling pathway
    718040 (ITPR3)
   04935 Growth hormone synthesis, secretion and action
    718040 (ITPR3)
   04918 Thyroid hormone synthesis
    718040 (ITPR3)
   04928 Parathyroid hormone synthesis, secretion and action
    718040 (ITPR3)
   04924 Renin secretion
    718040 (ITPR3)
   04925 Aldosterone synthesis and secretion
    718040 (ITPR3)
   04927 Cortisol synthesis and secretion
    718040 (ITPR3)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    718040 (ITPR3)
  09154 Digestive system
   04970 Salivary secretion
    718040 (ITPR3)
   04971 Gastric acid secretion
    718040 (ITPR3)
   04972 Pancreatic secretion
    718040 (ITPR3)
  09156 Nervous system
   04724 Glutamatergic synapse
    718040 (ITPR3)
   04725 Cholinergic synapse
    718040 (ITPR3)
   04728 Dopaminergic synapse
    718040 (ITPR3)
   04726 Serotonergic synapse
    718040 (ITPR3)
   04720 Long-term potentiation
    718040 (ITPR3)
   04730 Long-term depression
    718040 (ITPR3)
   04723 Retrograde endocannabinoid signaling
    718040 (ITPR3)
  09157 Sensory system
   04742 Taste transduction
    718040 (ITPR3)
   04750 Inflammatory mediator regulation of TRP channels
    718040 (ITPR3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    718040 (ITPR3)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    718040 (ITPR3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    718040 (ITPR3)
   05012 Parkinson disease
    718040 (ITPR3)
   05014 Amyotrophic lateral sclerosis
    718040 (ITPR3)
   05017 Spinocerebellar ataxia
    718040 (ITPR3)
   05020 Prion disease
    718040 (ITPR3)
   05022 Pathways of neurodegeneration - multiple diseases
    718040 (ITPR3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    718040 (ITPR3)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    718040 (ITPR3)
   05163 Human cytomegalovirus infection
    718040 (ITPR3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    718040 (ITPR3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mcc01009]
    718040 (ITPR3)
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mcc04040]
    718040 (ITPR3)
Protein phosphatases and associated proteins [BR:mcc01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     718040 (ITPR3)
Ion channels [BR:mcc04040]
 Ligand-gated channels
  IP3 receptor
   718040 (ITPR3)
SSDB
Motif
Pfam: Ins145_P3_rec RYDR_ITPR MIR RIH_assoc Ion_trans
Other DBs
NCBI-GeneID: 718040
NCBI-ProteinID: XP_014991603
Ensembl: ENSMMUG00000047729
UniProt: G7MRR0
LinkDB
Position
4
AA seq 2671 aa
MSEMSSFLHIGDIVSLYAEGSVNGFISTLGLVDDRCVVEPAAGDLDNPPKKFRDCLFKVC
PMNRYSAQKQYWKAKQTKQDKEKIADVVLLQKLQHAAQMEQKQNDTENKKVHGDVVKYGS
VIQLLHMKSNKYLTVNKRLPALLEKNAMRVTLDATGNEGSWLFIQPFWKLRSNGDNVVVG
DKVILNPVNAGQPLHASNYELSDNAGCKEVNSVNCNTSWKINLFMQFRDHLEEVLKGGDV
VRLFHAEQEKFLTCDEYKGKLQVFLRTTLRQSATSATSSNALWEVEVVHHDPCRGGAGHW
NGLYRFKHLATGNYLAAEENPSYKGDASDPKATGMGAQGRAGRRNAGEKIKYRLVAVPHG
NDIASLFELDPTTLQKTDSFVPRNSYVRLRHLCTNTWIQSTNVPIDIEEERPIRLMLGTC
PTKEDKEAFAIVSVPVSEIRDLDFANDASSMLASAVEKLNEGFISQNDRRFVIQLLEDLV
FFVSDVPNNGQNVLDIMVTKPNRERQKLMREQNILKQIFGILKAPFREKGGEGPLVRLEE
LSDQKNAPYQHMFRLCYRVLRHSQEDYRKNQEHIAKQFGMMQSQIGYDILAEDTITALLH
NNRKLLEKHITKTEVETFVSLVRKNREPRFLDYLSDLCVSNHIAIPVTQELICKCVLDPK
NSDILIQTELRPVKEMAQSHEYLSIEYSDEEVWLTWTDKNNEHHEKSVRQLAQEARAGNA
HDENVLSYYRYQLKLFARMCLDRQYLAIDEISQQLGVDLIFLCMADEMLPFDLRASFCHL
MLHVHVDRDPQELVTPVKFARLWTEIPTAITIKDYDSNLNASRDDKKNKFANTMEFVEDY
LNNVVSEAVPFANEEKNKLTFEVVSLAHNLIYFGFYSFSELLRLTRTLLGIIDCVQGPPA
MLQAYEDPGGKNVRRSIQGVGHMMSTMVLSRKQSVFGAPSLPAGASAAEPLDRSKFEENE
DIVVMETKLKILEILQFILNVRLDYRISYLLSVFKKEFVEVFPMQDSGADGTAPAFDSTT
ANMNLDRIGEQAEAMFGVGKTSSMLEVDDEGGRMFLRVLIHLTMHDYAPLVSGALQLLFK
HFSQRQEAMHTFKQVQLLISAQDVENYKVIKSELDRLRTMVEKSELWVDKKGSGKGEEVE
AGAAKDKKERPTDEEGFLHPPGEKSSENYQIVKGILERLNKMCGVGEQMRKKQQRLLKNM
DAHKVMLDLLQIPYDKGDAKMMEILRYTHQFLQKFCAGNPGNQALLHKHLHLFLTPGLLE
AETMQHIFLNNYQLCSEISEPVLQHFVHLLATHGRHVQYLDFLHTVIKAEGKYVKKCQDM
IMTELTNAGDDVVVFYNDKASLAHLLDMMKAARDGVEDHSPLMYHISLVDLLAACAEGKN
VYTEIKCTSLLPLEDVVSVVTHEDCITEVKMAYVNFVNHCYVDTEVEMKEIYTSNHIWML
FENFTLDMARVCSKREKRVADPALEKYVLSVVLDTINAFFSSPFSENSTSLQTHQTIVVQ
LLQSTTRLLECPWLQQQHKGSVEACIRTLAMVAKGRAISLPMDLDAHISSMLSSGASCAA
AAQRNASSYKATTRAFPRVTPTANQWDYKNIIEKLQDIITALEERLKPLVQAELSVLVDV
LHWPELLFLEGSEAYQRCESGGFLSKLIQHTKDLMESEEKLCIKVLRTLQQMLLKKTKYG
DRGNQLRKMLLQNYLQNRKSTSRGDLPDPMGTGLDPDWSAIAATQCRLDKEGATKLVCDL
ITSTKNEKIFQESIGLAIRLLDGGNTEIQKSFHNLMMSDKKSERFFKVLHDRMKRAQQET
KSTVAVNMNDLGSQPHEDREPVDPTTKGRVASFSIPGSSSRYSLGPSLRRGHEVSERVQS
NEMGTSVLIMQPILRFLQLLCENHNRDLQNFLRCQNNKTNYNLVCETLQFLDIMCGSTTG
GLGLLGLYINEDNVGLVIQTLETLTEYCQGPCHENQTCIVTHESNGIDIITALILNDISP
LCKYRMDLVLQLKDNASKLLLALMESRHDSENAERILISLRPQELVDVIKKAYLQEEERE
NSEVSPREVGHNIYILALQLSRHNKQLQHLLKPVKRIQEEEAEGISSMLSLNNKQLSQML
KSSVPAQEEEEDPLAYYENHTSQIEIVRQDRSMEQIVFPVPGICQFLTEETKHRLFTTTE
QDEQGSKVSDFFDQSSFLHNEMEWQRKLRSMPLIYWFSRRMTLWGSISFNLAVFINIIIA
FFYPYMEGASTGVLDSPLISLLFWILICFSIAALFTKRYSIRPLIVALILRSIYYLGIGP
TLNILGALNLTNKIVFVVSFVGNRGTFIRGYKAMVMDMEFLYHVGYILTSVLGLFAHELF
YSILLFDLIYREETLFNVIKSVTRNGRSILLTALLALILVYLFSIVGFLFLKDDFILEVD
RLPNNHSTASPLGMPHGAAAFVDTCSGDKMDCVSGVSVPEVLEEDGELDNTERACDTLLM
CIVTVMNHGLRNGGGVGDILRKPSKDESLFPARVVYDLLFFFIVIIIVLNLIFGVIIDTF
ADLRSEKQKKEEILKTTCFICGLERDKFDNKTVSFEEHIKLEHNMWNYLYFIVLVRVKNK
TDYTGPESYVAQMIKNKNLDWFPRMRAMSLVSNEGEGEQNEIRILQDKLNSTMKLVSHLT
AQLNELKEQMTEQRKRRQRLGFVDVQNCMSR
NT seq 8016 nt   +upstreamnt  +downstreamnt
atgagtgaaatgtccagctttcttcacatcggggacatcgtctccctgtacgccgagggc
tccgtcaatggcttcatcagcactttggggctggtggatgaccgctgtgtggtggagcct
gcggccggggacctggacaaccctcctaagaagttccgagactgcctcttcaaggtgtgc
cccatgaaccgctactcggcccagaagcagtactggaaggccaagcagaccaagcaggac
aaggagaagatcgctgatgtggtgttgctgcagaagctgcagcatgcggcccaaatggag
cagaagcaaaacgacacggagaacaagaaggtgcacggggatgtcgtgaagtatggaagt
gtgatccagctcctgcacatgaagagcaacaagtacctgacggtgaacaagcggcttccg
gccttgctggagaagaacgccatgcgggtgaccctggatgccacaggcaacgagggttcc
tggctcttcatccagcccttctggaagctgcggagcaatggggacaacgtggtcgtgggg
gacaaggtgatcctgaatcctgtcaacgccgggcagcctctgcatgccagcaattacgaa
ctcagcgataatgccggctgcaaggaggtcaactctgtgaactgcaacaccagctggaag
atcaatctgtttatgcagttccgggaccacctggaggaggtgttgaaagggggagacgtg
gtgcggttgttccatgcggagcaggagaagttcctgacctgtgacgagtacaagggcaag
ctgcaggtgttcctgagaaccacactgcgccagtcggccacctcggccaccagctccaat
gctctctgggaggtggaggtggtccaccacgacccctgccgtggaggagctgggcactgg
aatggcctgtaccgcttcaagcacctggccacgggcaactacctggctgctgaggagaac
cccagttacaaaggtgatgcctcggatcccaaggcaacaggaatgggggcccagggccgt
gcaggccgcaggaatgctggggagaagatcaagtaccgcctggtggccgtgcctcatggc
aatgacattgcctctctctttgagctggaccccaccaccttgcagaaaaccgactctttt
gtgccccggaactcgtacgtccggctgcggcacctctgcaccaacacgtggatccagagc
accaatgtgcccattgacatcgaggaggaacggcccatccggcttatgctgggtacctgc
cccactaaggaagacaaggaggcctttgccatcgtgtcggtgcctgtgtccgagatccga
gacctggactttgccaatgatgccagctccatgctggccagcgccgtggagaaactcaat
gagggcttcatcagccagaatgaccgcaggtttgtcatccagctgctggaagacctggtg
ttctttgtcagtgatgtccccaacaatgggcagaatgtcctggacatcatggtcaccaag
cccaaccgggaacggcagaagctgatgagagagcagaacatcctcaaacagatctttggc
attctgaaggccccgttccgtgagaaggggggtgaaggtcccctggtgcggctggaggag
ctgtcagaccagaagaatgccccctatcagcacatgttccgtctgtgctaccgtgtgctg
cggcattcccaggaggactaccgcaagaaccaggagcacatcgccaagcagtttgggatg
atgcagtcccagattggctatgacatcttggctgaggacaccatcaccgccctgctgcac
aacaatcgcaagctcctggaaaagcacatcaccaagaccgaggtggagaccttcgtcagc
cttgtgcgcaagaaccgggagcccaggttcctggactacctctctgacctatgtgtgtcc
aaccacattgccatccccgtcacccaggagctcatctgcaagtgtgtgctggaccccaag
aacagtgacattctcatccagaccgaacttcggcccgtaaaggagatggcccaatcccac
gagtacctgagcatcgagtactcagacgaggaagtgtggctcacgtggactgacaagaat
aacgagcaccatgagaagagtgtgaggcagctggcccaggaggcgcgggccggcaacgcc
cacgacgagaatgtgctcagctactacaggtaccagctgaagctctttgcccgcatgtgc
ttggaccgccagtacttggccatcgatgagatctcccagcagctgggtgtggacctgatt
ttcctgtgcatggcggatgagatgctgccctttgacctgcgcgcctccttctgccacctg
atgctgcacgtgcatgtggaccgcgacccccaggagctggtcacgccggtcaagtttgcc
cgtctctggactgagatccccacagccatcaccatcaaggactatgattccaacctcaac
gcatcccgagatgacaagaagaacaagtttgccaacaccatggagttcgtggaggactac
ctcaacaatgtggtcagcgaggctgtgccctttgccaacgaggagaagaacaagctcact
tttgaggtggtcagcctggcgcacaacctcatctacttcggcttctacagcttcagcgag
ctgctgcggctcactcgcacactgctgggcatcatcgactgtgtgcaggggcccccggcc
atgctgcaggcctatgaggaccccggtggcaagaatgtgcggcggtccatccagggcgtg
gggcacatgatgtccaccatggtgctgagccgcaagcagtcagtcttcggtgcccccagc
ctgcctgctggggccagtgctgctgaaccgctggacagaagcaagtttgaggagaatgag
gacattgtggtgatggagaccaagctgaagatcctggaaatccttcagttcatcctcaat
gtccgcctggattaccgcatctcctatctgctgtctgtcttcaagaaggagttcgtggag
gtgtttcccatgcaggacagcggggctgatggcacagcccctgccttcgactccaccact
gccaacatgaacctggatcgtatcggggagcaggcggaggccatgtttggagtggggaag
acaagcagcatgctggaggtggatgacgagggcggccgcatgttcctgcgcgtgctcatc
cacctcaccatgcacgactatgcgccgctggtctcgggtgccctgcagctgctcttcaag
cacttcagccagcgccaggaggccatgcacaccttcaagcaggttcagctgctgatctca
gcgcaggacgtggagaactacaaggtgatcaagtcagagctggaccggctgcggaccatg
gtggagaagtcagagctgtgggtggacaagaagggcagcggcaagggtgaggaggtggag
gcaggcgcagccaaggacaagaaggagcggcccacggacgaggagggctttctgcaccca
ccaggggagaaaagcagtgagaactaccagattgtcaagggcatcctggaaaggctgaat
aagatgtgcggggtcggggagcaaatgaggaagaagcagcaacggctgctgaagaacatg
gatgcccacaaggtcatgctggacctgctgcagatcccctacgacaagggtgatgccaag
atgatggagatcctacgctacacgcaccagttcctacagaagttctgtgcagggaaccct
ggcaaccaggccctgctgcacaagcacctgcaccttttcctcacaccagggctcctggag
gcagagaccatgcaacacatcttcctgaacaactatcagctctgctccgagatcagcgag
cccgtgttgcagcacttcgtgcacctgctggccacgcacgggcgccatgtgcagtacctg
gacttcctgcacacggtcatcaaggctgagggcaagtacgtcaagaagtgccaggacatg
atcatgactgagctgaccaatgcaggtgacgatgtggtcgtgttctacaacgataaggca
tcgctggcccacctgctggacatgatgaaggccgcccgcgatggcgtggaggaccacagc
cccctcatgtaccacatttccctggtggacctgctggctgcctgcgccgagggcaaaaac
gtctacactgagatcaagtgcacctccctgctgccgctggaggatgtggtgtctgtggtg
acgcatgaggactgcatcactgaggtgaaaatggcctatgtgaacttcgtgaaccactgc
tatgtggacacggaggtggagatgaaggagatctataccagcaaccacatctggatgctc
tttgagaacttcaccctggacatggcgcgggtctgcagcaagcgtgagaagcgtgtggct
gaccccgccctggagaagtacgtgctgagcgtcgtgctggacaccatcaacgccttcttc
agctccccgttctctgagaacagcacttccctgcagacacaccagacgattgtggtgcag
ctgctgcagtccaccacacggctcctcgagtgtccgtggctacagcagcagcataagggc
tctgtggaggcctgcatccggaccctcgccatggtggccaagggccgggccatctcgctg
cccatggacctggacgcccacatcagctcgatgctcagcagtggagccagctgtgcagct
gccgcccagcggaacgcctccagctacaaggcaaccacgcgggccttcccccgcgtcacc
cccaccgctaaccagtgggactacaagaacatcattgagaagctgcaggacatcatcaca
gccctggaggagcggctgaagcccctggtgcaggctgagctgtccgtgctggtggacgtc
ctgcactggcctgagctgctcttcctggagggcagtgaggcctaccagcgctgcgagagt
gggggcttcctgtccaagctgatccagcacaccaaggacctcatggagtcggaggagaag
ctgtgcatcaaggtgctgcggaccctgcagcagatgctgctcaagaaaaccaagtatggg
gaccggggcaatcagctgcgcaagatgctgctgcaaaactacctccagaaccggaagtcc
acctcgcggggggaccttcccgaccccatgggcactggcctggacccagactggtcggca
atcgcagccacgcagtgccggctggacaaggagggggccaccaagttggtatgcgacctc
atcaccagcaccaagaatgagaagatcttccaggagagcattggcctggccatccgcctg
ctggatggtggcaacacagagatccagaaatctttccacaacctgatgatgagtgacaag
aagtcagagcgcttcttcaaggtgctgcacgaccgcatgaagcgggcccagcaggagacc
aagtccaccgtggcagtcaacatgaatgacctgggcagccagccacatgaggaccgtgag
ccagtcgaccccaccactaaaggccgcgtggcctccttctccatacctggctcctcatcc
cgctactcgctgggccccagcctgcgccgggggcacgaagtgagcgaacgtgtgcagagc
aacgagatgggcacgtctgtgctcatcatgcagcccatcctgcgctttctgcagctgctg
tgcgagaatcacaaccgggacctgcagaacttcctgcgctgtcagaacaacaaaaccaac
tacaacttggtgtgcgagacgctgcagttcctggacatcatgtgcggcagcaccacgggt
ggcctggggctgctggggctctacatcaatgaggacaatgtgggcctcgtcatccagacc
ttggagaccctcactgagtactgccagggcccctgccatgagaaccagacctgcattgtg
actcacgagtccaatggcatagacatcatcaccgcactgatcctcaatgacatcagcccc
ctgtgcaagtaccgcatggatctggtgctgcagctcaaggacaatgcctccaaactgctc
ctggctctgatggagagccggcatgacagtgaaaatgccgagcgcatcctcatcagcctg
cggccccaggagctggtggacgtcatcaagaaggcctacctgcaggaagaagagcgtgag
aactcggaggtgagcccacgtgaagtgggccacaacatctacatcctggcgctgcagctc
tccaggcacaataaacagctgcagcacctgctgaagccggtgaagcgcattcaagaggag
gaggccgagggtatctcttccatgctcagcctcaacaacaagcagctgtcacagatgctc
aagtcctcagtgccagcacaggaggaggaggaagaccccctggcctactacgagaaccac
acgtcccagatcgagattgtgcggcaggaccgcagcatggagcagatcgtgttccccgtg
cctggcatctgccagttcctgacggaggagaccaagcaccggctcttcaccactaccgag
caggacgagcagggcagcaaagtgagcgacttctttgaccagtcctccttcctgcacaac
gagatggagtggcagcgcaagctccgcagcatgccgctgatctactggttctcccgccgc
atgaccctgtggggcagcatctccttcaacctggccgtgtttatcaacatcatcattgcc
ttcttctacccctacatggagggcgcgtccacaggcgtgctggactcccctctcatctca
ctgctgttctggatcctcatctgcttctccatcgcggccctgttcaccaagcgctacagc
attcgccccctcatcgtggcgctcatcctacgctccatctactatctgggcatcgggccc
actctcaacatcctgggtgccctcaatctgaccaataagatcgtgtttgtggtgagcttc
gtgggcaaccgtggcaccttcatccggggctataaggccatggtcatggacatggaattc
ctctaccacgtgggctacatcctgaccagtgtcctgggcctctttgctcatgagctgttc
tacagcatcctgctctttgacctcatctaccgcgaggagaccctattcaacgtcatcaag
agtgtgacccgcaatggccgctccatcctgctgacagccctgctggccctcatcctggtc
tacctcttctccatcgttggcttcctcttcctcaaggatgacttcatccttgaggtcgac
cgactgcccaacaaccactccacagccagccccctggggatgccacatggagctgctgca
tttgtggacacctgcagtggggacaagatggactgtgtctcaggggtctcggtgcccgag
gtcctggaagaggatggggagctggacaacacagagcgggcctgtgacactctgctgatg
tgcatcgtcactgtcatgaaccatgggctacgcaacggtggtggtgtaggcgacattctc
cgcaagccctccaaagatgagtctctcttcccagcgagagtggtctatgacctcctgttc
ttcttcatcgtcatcatcatcgtgctgaacctcatctttggggtaatcatcgacaccttc
gctgacctgcgtagtgagaagcagaagaaggaggagattctcaagacgacatgcttcatc
tgtggtctggagagggacaagtttgataacaagacggtgtcatttgaggaacacatcaag
ctggagcacaacatgtggaactacttgtatttcattgtcctggtccgtgtgaagaacaag
accgactacacaggccctgagagctacgtggcccagatgatcaagaacaagaacctggac
tggttcccccggatgcgggccatgtcccttgtcagcaacgagggcgagggggagcagaat
gagattcggattctccaggacaagctcaactccaccatgaagctggtgtcccacctcact
gcccagctcaatgagctcaaggagcagatgacagagcagcggaaacgcaggcaacgccta
ggctttgtggatgtccagaactgcatgagccgctga

DBGET integrated database retrieval system