KEGG   Macaca mulatta (rhesus monkey): 703838
Entry
703838            CDS       T01028                                 

Gene name
RASGRP1
Definition
(RefSeq) RAS guanyl-releasing protein 1 isoform X3
  KO
K04350  RAS guanyl-releasing protein 1
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04010  MAPK signaling pathway
mcc04014  Ras signaling pathway
mcc04611  Platelet activation
mcc04660  T cell receptor signaling pathway
mcc05200  Pathways in cancer
mcc05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    703838 (RASGRP1)
   04014 Ras signaling pathway
    703838 (RASGRP1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    703838 (RASGRP1)
   04660 T cell receptor signaling pathway
    703838 (RASGRP1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    703838 (RASGRP1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    703838 (RASGRP1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mcc04990]
    703838 (RASGRP1)
Domain-containing proteins not elsewhere classified [BR:mcc04990]
 EF-hand domain-containing proteins
  Other EF-hand domain-containing proteins
   703838 (RASGRP1)
SSDB
Motif
Pfam: RasGEF C1_1 EF-hand_6 EF-hand_1 EF-hand_7 RasGEF_N EF-hand_5 EF-hand_8 SAT SPARC_Ca_bdg bZIP_1 UPF0242
Other DBs
NCBI-GeneID: 703838
NCBI-ProteinID: XP_001092164
Ensembl: ENSMMUG00000018333
UniProt: F6TUV4
LinkDB
Position
7
AA seq 797 aa
MGTLGKAREAPRKPSHGCRAAPKARLEAKPANSPFPSHPSLAQITQFRMMVSLGHLAKGA
SLDDLIDSCIQSFDADGNLCRRNHLLQVVLTMHRIIVSSAELLRKVVTLYKDALAKNSPG
LCLKICYFVRYWITEFWVMFKMDASLTDTMEEFQELVKAKGEELHCRLIDTTQINARDWS
RKLTQRIKSNTSKKRKVSLLFDHLEPEELSEHLTYLEFKSFRRISFSDYQNYLVNSCVKE
NPTMERSIALCNGISQWVQLMVLSRPTPQLRAEVFIKFIQVAQKLHQLQNFNTLMAVIGG
LCHSSISRLKETSSHVPHEINKVLGEMTELLSSSRNYDNYRRAYGECTDFKIPILGVHLK
DLISLYEAMPDYLEDGKVNVHKLLALYNHISELVQLQEVAPPLEANKDLVHLLTLSLDLY
YTEDEIYELSYAREPRNHRAPPLTPSKPPVVVDWASGVSPKPDPKTISKHVQRMVDSVFK
NYDHDQDGYISQEEFEKIAASFPFSFCVMDKDREGLISRDEITAYFMRASSIYSKLGLGF
PHNFQETTYLKPTFCDNCAGFLWGVIKQGYRCKDCGMNCHKQCKDLVVFECKKRAKNPVA
PTENNTSVGPVSNLCSLGAKDLLHAPEEGPFTFPNGEAVEHAEESKDRTIMLMGVSSQKI
SLRLKRTVAHKATQTESQPWIGSESPSGPFVLSSPRKTAQDTLYVLPSPTSPCPSPVLVR
KRAFVKWENKDSLIKSKEELRHLRLPTYQELEQEINTLKADNDALKIQLKYAQKKIESLQ
LEKSNHVLAQMEQSDCS
NT seq 2394 nt   +upstreamnt  +downstreamnt
atgggcaccctgggcaaggcgagagaggctccgcggaaaccttcccatggctgcagagct
gcccctaaagcaagactagaggcgaagccagccaacagccccttcccctcccatcccagc
ttggcccagatcacccagttccgaatgatggtgtctctgggacatttagccaaaggagcc
agcctggacgatctcattgacagctgcattcaatcttttgatgcggatggaaacctgtgt
cgaaggaaccacctgttgcaagtcgtcctgaccatgcatcggattatcgtctcctctgca
gagctgctccgaaaagttgtcaccctctataaggatgctttggcaaagaattcaccagga
ctttgcctgaagatctgctattttgtaaggtattggataacagaattctgggtcatgttt
aaaatggatgccagcttgacagacactatggaggagtttcaggaactggtgaaagctaag
ggtgaggagttacactgccgcctgattgacacaactcaaatcaatgcccgtgactggtcc
aggaaacttactcaaaggataaaatcaaataccagcaagaaacggaaagtctccctgctc
tttgaccatctggaaccggaagagctatccgagcacctcacctacctggagttcaagtcc
ttccgaaggatatcattctctgattatcagaattaccttgtaaatagctgtgtgaaggaa
aaccccaccatggagagatctattgctctgtgcaacggcatctcccagtgggtacagctg
atggttctcagccgccccaccccgcagctccgagcggaagtcttcatcaagttcatccag
gtggctcagaagctccaccaactacagaacttcaatacgctgatggctgtgataggtggg
ctgtgtcacagctcaatctcgaggctcaaggagacaagttcgcatgtcccacatgaaatc
aataaggttctcggtgagatgactgagctgctgtcctcctccagaaactatgacaattat
cggcgagcctatggagagtgcaccgacttcaagatccccattctgggtgtgcatctcaag
gacctcatctccctgtatgaagccatgcctgactacctggaggacgggaaagtgaacgtc
cacaagctactggccctgtacaatcatatcagtgaattggtccagctgcaagaggtggcc
ccacctttggaggccaacaaggacttggtacacttgctgacgctatccctggatctctac
tacactgaggatgaaatctatgagctttcctatgcccgggaaccaaggaaccacagagct
ccaccactaacaccttcaaagccaccagtagtagtggactgggcttctggagtatctccc
aaacctgatccaaagaccattagcaaacacgtccagaggatggtggattctgtcttcaag
aactatgatcacgaccaggatggatacatttctcaggaagaatttgaaaagattgctgcg
agttttccattttccttctgtgtgatggacaaagacagggaaggcctcatcagcagggat
gagatcacagcctacttcatgcgagccagctcaatctattccaagctgggcctgggcttt
cctcacaacttccaagagaccacctacctgaagcccactttttgtgacaactgtgctgga
tttctctggggagtgatcaaacaaggatatcgatgtaaagactgcgggatgaactgccac
aaacagtgcaaagatctggttgtgtttgagtgcaagaagcgagccaagaacccagtagct
cccacagagaacaacacctctgtggggccagtgtccaacctttgctcattgggagccaaa
gatctgctccatgcacctgaggaaggaccttttacgttccctaatggggaggctgtggaa
cacgctgaggagagtaaggatcggaccatcatgctgatgggagtgtcctcacagaagatt
tctcttcggctgaagaggactgttgcccacaaggccacccagactgaatcacagccttgg
attggcagtgagagcccttcaggtccctttgtgctgtcttccccaaggaagacagcccag
gatactctttatgtgcttcccagccccacctctccatgtcccagcccggtcttggtcaga
aagcgggcttttgtcaagtgggagaataaagactccctcataaaatcaaaggaggagctc
cgtcacctgagactgcctacctaccaagagctggaacaggaaataaatactctgaaagca
gataatgatgccctaaagattcaactgaaatatgcacagaagaaaatagaatccctccag
cttgaaaaaagcaatcatgtcttagctcaaatggagcagagtgactgttcttag

KEGG   Macaca mulatta (rhesus monkey): 707225
Entry
707225            CDS       T01028                                 

Gene name
RASGRP3
Definition
(RefSeq) ras guanyl-releasing protein 3
  KO
K12362  RAS guanyl-releasing protein 3
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04010  MAPK signaling pathway
mcc04014  Ras signaling pathway
mcc04015  Rap1 signaling pathway
mcc04662  B cell receptor signaling pathway
mcc05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    707225 (RASGRP3)
   04014 Ras signaling pathway
    707225 (RASGRP3)
   04015 Rap1 signaling pathway
    707225 (RASGRP3)
 09150 Organismal Systems
  09151 Immune system
   04662 B cell receptor signaling pathway
    707225 (RASGRP3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    707225 (RASGRP3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mcc04990]
    707225 (RASGRP3)
Domain-containing proteins not elsewhere classified [BR:mcc04990]
 EF-hand domain-containing proteins
  Other EF-hand domain-containing proteins
   707225 (RASGRP3)
SSDB
Motif
Pfam: RasGEF C1_1 EF-hand_6 EF-hand_1 EF-hand_7 EF-hand_5 EF-hand_8 RasGEF_N
Other DBs
NCBI-GeneID: 707225
NCBI-ProteinID: NP_001248629
Ensembl: ENSMMUG00000045520
UniProt: H9EU58
LinkDB
Position
13
AA seq 690 aa
MGSSGLGKAATLDELLHTCIEMFDDNGELNNSYLPRIVLLMHRWYLSSTELAEKLLCMYR
NATGESCNEFRLKICYFMRYWILKFPAEFNLDLGLIRMTEEFREVASQLGYEKHVSLIDI
SSIPSYDWMRRVTQRKKISKKGKACLLFDHLEPIELAEHLTFLEHKSFRRISFTDYQSYV
IHGCLENNPTLERSIALFNGISKWVQLMVLSKPTPQQRAEVITKFINVAKKLLQLKNFNT
LMAVVGGLSHSSISRLKETHSHLSSEVTKNWNEMTELVSSNGNYCNYRKAFADCDGFKIP
ILGVHLKDLIAVHVIFPDWTEENKVNIVKMHQLSVTLSELVSLQNASHHLEPNMDLINLL
TLSLDLYHTEDDIYKLSLVLEPRNSKSQPTSPTTPNKPVVPLEWALGVMPKPDPTVINKH
IRKLVESVFRNYDHDHDGYISQEDFESIAANFPFLDSFCVLDKDQDGLISKDEMMAYFLR
AKSQLHCKMGPGFIHNFQEMTYLKPTFCEHCAGFLWGIIKQGYKCKDCGANCHKQCKDLL
VLACRRFARAPSLSSGHGSLPGSPSLPPAQDEVFEFPGVTAGHRDLDSRAITLVTGSSRK
ISVRLQRATTSQATQTEPVWSEAGWGDSGSHTFPKMKSKFHDKAAKDKGFAKWENEKPRV
HAGVDVVDRGTEFEPDQDEGEETRQDGEDG
NT seq 2073 nt   +upstreamnt  +downstreamnt
atgggatcaagtggccttgggaaagcagcaacattagatgaactgctgcacacttgcatt
gagatgtttgatgacaatggagagctgaataatagttacttgccaagaatagttctactg
atgcaccgatggtatttatcttccactgagttggcagaaaaacttctctgcatgtatcga
aatgccactggagaaagctgcaatgaatttcgattaaagatctgctacttcatgaggtac
tggattctgaaatttcctgcagagtttaatttggatcttggtttgattcgtatgactgag
gaattccgggaagtagccagtcaactaggatatgaaaaacacgtcagcctcatcgacata
tccagcattccttcctatgactggatgagaagagtcacacagaggaaaaaaatatccaag
aagggaaaagcctgtctgctgtttgaccatctggagcccattgaattggctgagcacctc
acttttctggagcataaatcttttagaaggatctcattcactgattaccaaagctatgtc
atccatggctgcctggagaataatccaactttggaaagatcgatagctttatttaatgga
atctctaagtgggtccaattgatggttcttagcaaaccaaccccccagcaaagggcagaa
gtcatcacaaagtttatcaatgttgcaaagaagctccttcagctcaaaaattttaacacc
ctgatggcagtggtgggaggcctcagtcatagttccatttcacgcctcaaagagacgcat
tctcatctttcttcagaagttacaaagaactggaatgaaatgacagagttggtctcctcc
aacggtaattactgcaattaccgcaaggcctttgccgactgtgatggcttcaaaatcccc
atccttggagtacacttgaaagacttgatagcagtccatgtcattttcccagactggacg
gaggagaacaaagtgaacattgtgaaaatgcaccagctctccgttaccctgagtgaacta
gtctccctgcagaatgcctctcaccacctagaacccaacatggatttgatcaacctgctc
acgctttccctcgacctctatcacactgaagatgatatttacaaactgtcactggtgctg
gagcctagaaattctaaatcgcagcctacctcccctacaacacccaacaagcctgtggtg
cccctcgagtgggcattaggggtgatgccaaagccagaccccacggtcatcaacaagcac
ataaggaaattagttgagtctgtatttagaaactatgatcatgaccatgacgggtacatt
tcccaagaggactttgaaagtatagctgccaattttcccttcttggattccttctgtgtg
ctggacaaagatcaggacggcctaattagtaaagatgaaatgatggcttacttcctgaga
gcgaaatcccaactacactgtaaaatgggaccaggatttatccataattttcaggagatg
acctatctcaaaccaaccttctgcgaacactgtgcaggattcctctggggcataatcaag
caaggatacaaatgcaaagactgtggagccaattgtcacaaacagtgcaaagacctcctg
gttctggcctgcaggagatttgcccgggcaccctccttgagcagtggtcatgggtcactg
cctggaagcccctcgctgcccccagcacaggatgaggtgtttgagttccctggagtcact
gctggacacagggatttagacagcagagccatcacactggttacaggctcttctcgcaag
atctccgtgaggctacagagggccaccaccagccaggccacccagactgaacctgtctgg
tcagaggctggctggggggactcagggtcccacaccttccctaaaatgaaatccaagttc
catgacaaagcagcaaaggacaaaggctttgccaaatgggaaaatgagaagcccagggtg
catgctggtgtggatgttgtagaccggggcacggagttcgaacctgaccaggatgaagga
gaagagaccagacaggatggtgaggatggctga

KEGG   Macaca mulatta (rhesus monkey): 719595
Entry
719595            CDS       T01028                                 

Gene name
RASGRP4
Definition
(RefSeq) RAS guanyl-releasing protein 4
  KO
K12363  RAS guanyl-releasing protein 4
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04010  MAPK signaling pathway
mcc04014  Ras signaling pathway
mcc05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    719595 (RASGRP4)
   04014 Ras signaling pathway
    719595 (RASGRP4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    719595 (RASGRP4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mcc04990]
    719595 (RASGRP4)
Domain-containing proteins not elsewhere classified [BR:mcc04990]
 EF-hand domain-containing proteins
  Other EF-hand domain-containing proteins
   719595 (RASGRP4)
SSDB
Motif
Pfam: RasGEF C1_1 EF-hand_7 EF-hand_6 RasGEF_N EF-hand_1 SAMP
Other DBs
NCBI-GeneID: 719595
NCBI-ProteinID: XP_001114059
Ensembl: ENSMMUG00000020469
LinkDB
Position
19
AA seq 673 aa
MNRKDSKRKSHQECTGKTGGRGRPRQTRRHKTCPSPREISKVMASMNLGLLSEGGCSEDE
LLEKCIQSFDSAGSLCHGDHMLNMVLAMHSWVLPSADLAARLLTKYQKATGDTQELRRLQ
ICHLVRYWLTQHPEVMHQDPQLEEVIGRFWATVAQEGNSAQRNLRDSSNLLSPGGPGPPP
PMSSPGLGKKRKVSLLFDHLETGELAQHLTYLEFRSFQAITPQDLRSYVLQGSVRGCPAL
EGSVGLSNSVSRWVQVMVLSRPGPLQRAQVLDKFIHVAQRLRQLQNFNTLMAVTGGLCHS
AISRLKDSHAHLSPDSTKALLELTEILASHNNYARYRRTWAGCTGFRLPVLGVHLKDLVS
LHEAQPDRLPDGRLHLPKLNNLYLRLQELVALQGQHPPCSANEDLLHLLTLSLDLFYTED
EIYELSYAREPRCPKSLPPSPFNAPLVVEWAPGVTPKPDRVTLGRHVEQLVESVFKNYDP
EGRGTISQEDFERLSGNFPFACHGLHPPPRQGRGSFSREELTGYLLRASAICSKLGLAFL
HTFHEVTFRKPTFCDSCSGFLWGVTKQGYRCRECGLCCHRHCRDQVKVECKKRPGGKGDA
GPPGAPVPCTPAPHASCGSEENLSYTLSLEPETGCQLRHAWTQTESPHPSWETDTVPCPV
MGPPSTASSKPDS
NT seq 2022 nt   +upstreamnt  +downstreamnt
atgaacagaaaagacagcaagagaaagtcccaccaggaatgcaccggaaagacaggaggg
cggggccggccccgccaaacacgccgccacaagacatgccccagcccccgggaaatcagc
aaggtcatggcttccatgaacctgggcctgctgagcgagggcggctgcagcgaagatgag
ctgctggagaaatgcatccagtcctttgattcagctggcagcctgtgccacggggaccac
atgctcaacatggtgctggccatgcatagctgggtgctgccctctgccgacctggctgcc
cgcctgctgaccaagtaccagaaggccacaggggacacccaggagctgagacggctgcag
atctgtcacctggtcaggtactggctgactcaacaccctgaggtgatgcaccaggacccc
cagctggaagaagtcataggtcgtttctgggccaccgtggcccaggagggcaactcggcc
cagagaaacctgagagactcctctaacctcctgagccctggtggccctggccccccaccc
cccatgagcagcccaggcctgggcaaaaagcgcaaagtgtccctgcttttcgaccacctg
gagacgggggagctggctcagcacctcacctacctggagttccgctccttccaggctatc
acgccccaggacctgcggagctacgttttgcagggctcagtacgaggctgccccgccctg
gagggctctgtaggtctcagcaacagcgtgtcccgctgggtgcaggtgatggtgctgagc
cgtcccgggcctctgcagcgcgcacaggtgctggacaagttcattcacgtggcacagagg
cttcgccagctgcagaatttcaacacgctgatggcggtcacggggggcctgtgtcacagt
gccatctccagactcaaggactcccatgcccacctgagccctgacagcaccaaggccctg
ctggagctcactgagatccttgcctcccacaacaactacgcccgctaccgccgcacctgg
gctggctgcacgggcttccggctgcctgtactgggcgtgcacctcaaggatctggtgtcc
ctgcatgaagcacagcccgacaggttgcctgacggccgcctgcacctacccaagttgaac
aacctctacctgcggctgcaggagctggtggccctccaagggcagcatccgccctgcagc
gccaacgaggatctgctgcacctgctcacactctccctggacctcttctacacggaagac
gagatctatgagctttcttatgcccgagagccacgctgtcccaagagtctgccaccctcc
cccttcaacgcacctctggtggtggagtgggcccctggtgtgacccccaagccggacagg
gtcacgctgggtcggcacgtggagcagctggtggagtccgtgttcaagaattatgaccct
gaaggccgaggaaccatctctcaggaggacttcgagcgactctcaggcaattttcccttc
gcctgccatgggctccacccgcccccacgccaggggagaggctccttcagcagagaggag
ctgacagggtacctgctccgggccagcgccatctgctccaagctgggcctggccttcctg
cacaccttccatgaggtcaccttccgaaagcctaccttctgcgacagctgcagtggcttt
ctctggggtgtcaccaagcaaggctaccgctgtcgggagtgtgggctgtgttgccacaga
cactgcagagaccaagtgaaggtggaatgtaagaagaggccggggggcaagggcgatgca
gggccccccggagctcctgttccatgcacaccagctccccatgccagctgtggctccgag
gaaaatctctcctacacgctatccctggaacctgagactgggtgccagcttcgccatgcc
tggacccagactgaatccccacacccttcctgggaaacagacacggtcccctgcccggta
atgggcccaccatcaactgcatcctccaagccggattcctag

KEGG   Macaca mulatta (rhesus monkey): 722044
Entry
722044            CDS       T01028                                 

Gene name
RASGRP2
Definition
(RefSeq) RAS guanyl-releasing protein 2
  KO
K12361  RAS guanyl-releasing protein 2
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04010  MAPK signaling pathway
mcc04014  Ras signaling pathway
mcc04015  Rap1 signaling pathway
mcc04062  Chemokine signaling pathway
mcc04611  Platelet activation
mcc05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    722044 (RASGRP2)
   04014 Ras signaling pathway
    722044 (RASGRP2)
   04015 Rap1 signaling pathway
    722044 (RASGRP2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    722044 (RASGRP2)
   04062 Chemokine signaling pathway
    722044 (RASGRP2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    722044 (RASGRP2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mcc04990]
    722044 (RASGRP2)
Domain-containing proteins not elsewhere classified [BR:mcc04990]
 EF-hand domain-containing proteins
  Other EF-hand domain-containing proteins
   722044 (RASGRP2)
SSDB
Motif
Pfam: RasGEF EF-hand_1 C1_1 EF-hand_6 EF-hand_7 EF-hand_5 RasGEF_N EF-hand_8
Other DBs
NCBI-GeneID: 722044
NCBI-ProteinID: NP_001248208
UniProt: H9ENK8
LinkDB
Position
14
AA seq 609 aa
MAGTLDLDKGCTVEELLRGCIEAFDDSGKVRDPQLVRMFLMMHPWYIPSSQLAAKLLHIY
QQSRKDNSNSLQVKTCHLVRYWISAFPAEFDLNPELAEQIKELKALLDQEGNRRHSSLID
IDSVPTYKWKRQVTQRNPVGQKKRKMSLLFDHLEPMELAEHLTYLEYRSFCKILFQDYHS
FVTHGCTVDNPVLERFISLFNSVSQWVQLMILSKPTAPQRALVITHFVHVAEKLLQLQNF
NTLMAVVGGLSHSSISRLKETHSHVSPETIKLWEGLTELVTATGNYGNYRRRLAACVGFR
FPILGVHLKDLVALQLALPDWLDPARTRLNGAKMKQLFSILEELAMVTSLRPPVQANPDL
LSLLTVSLDQYQTEDELYQLSLQREPRSKSSPTSPTSCTPPPRPPVLEEWTSAAKPKLDQ
ALVVEHIEKMVESVFRNFDVDGDGHISQEEFQIIRGNFPYLSAFGDLDQNQDGCISREEM
VSYFLRSSSVLGGRMGFVHNFQESNSLRPVACRHCKALILGIYKQGLKCRACGVNCHKQC
KDRLSVECRRRAQSVSLEGSAPSPSPTHSHHHRAFSFSLPRPGRRGSRPPEIREEEVQTV
EDGVFDIHL
NT seq 1830 nt   +upstreamnt  +downstreamnt
atggcgggcactctggacctggacaagggctgcacggtggaggagctgctccgcgggtgc
atcgaagccttcgatgactccgggaaggtacgggacccgcagctggtgcgcatgttcctc
atgatgcacccctggtacatcccctcctctcagctggcggccaagctgctccacatctac
caacaatcccggaaagacaactccaattccctgcaggtgaaaacgtgccacctggtcagg
tactggatctctgccttcccggcggagtttgacttgaacccggagctggctgagcagatc
aaggagctgaaggctctgctagaccaagaagggaaccggcggcacagcagcctcatcgac
atagacagcgtccctacctacaagtggaagcggcaggtgactcagcggaaccctgtggga
cagaaaaagcgcaagatgtccttgttgtttgaccacctggagcccatggagctggcggag
catctcacctacttggagtatcgctccttctgcaagatcctgtttcaggactatcacagt
tttgtgactcacggctgcactgtggacaaccccgtcctggagcggttcatctccctcttc
aacagcgtctcgcagtgggtgcagctcatgatcctcagcaaacctacagccccgcagcgg
gccctggtcatcacacactttgtccacgtggcagagaagctgctgcagctgcagaacttc
aacacgctgatggcagtggtcgggggcctgagccacagctccatctcccgcctcaaggag
acccacagccacgttagccctgagaccatcaagctctgggagggtctcacagaactagtg
acggcgacaggcaactatggcaactaccggcgccggctggcagcctgtgtgggcttccgc
ttccctatcctgggtgtgcacctcaaggacctggtggccttgcagctggcactgcctgac
tggctggacccagcccggacccggctcaacggggccaagatgaagcagctctttagcatc
ctggaggagctggccatggtgaccagcctgcggccaccagtacaggccaaccccgacctg
ctgagcctgctcacggtgtctctggatcagtatcagacggaggatgagctgtaccaactg
tccctgcagcgggagccgcgctccaagtcctcgccaaccagccccacgagttgcacccca
ccacctcggcccccggtgctggaggagtggacctcggctgccaaacctaagctggatcag
gccctcgtggtggagcacatcgagaagatggtggagtctgtgttccggaactttgacgtc
gatggggatggccacatctcacaggaagaattccagatcatccgtgggaacttcccttac
ctcagcgcctttggggacctcgaccagaaccaggatggctgcatcagcagggaggagatg
gtgtcctatttcctgcgctccagctctgtgctggggggccgcatgggcttcgtacacaac
ttccaggagagcaactccttgcgcccggtcgcctgccgccactgcaaagccctgatcctg
ggcatctacaagcagggcctcaaatgccgagcctgtggtgtgaactgccacaagcagtgc
aaggatcgcctgtcagttgagtgtcggcgcagggcccagagtgtaagcctggaggggtct
gcaccctcaccctcacccacacacagccaccatcaccgcgccttcagcttctccctgccc
cgccctggcaggcgaggctccaggcctccagagatccgtgaggaggaggtacagaccgtg
gaggatggggtttttgacatccacttgtaa

DBGET integrated database retrieval system