KEGG   Macaca mulatta (rhesus monkey): 703981
Entry
703981            CDS       T01028                                 

Gene name
NLRX1
Definition
(RefSeq) NLR family member X1 isoform X1
  KO
K12653  NLR family member X1
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04621  NOD-like receptor signaling pathway
mcc04622  RIG-I-like receptor signaling pathway
mcc05164  Influenza A
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    703981 (NLRX1)
   04622 RIG-I-like receptor signaling pathway
    703981 (NLRX1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    703981 (NLRX1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:mcc04054]
    703981 (NLRX1)
Pattern recognition receptors [BR:mcc04054]
 Cytoplasmic pattern recognition receptors
  NOD-like receptors
   703981 (NLRX1)
SSDB
Motif
Pfam: NACHT LRR_6 NOD2_WH AAA_16 AAA_22 DUF815 TsaE AAA_25
Other DBs
NCBI-GeneID: 703981
NCBI-ProteinID: XP_028689894
Ensembl: ENSMMUG00000012189
LinkDB
Position
14
AA seq 972 aa
MRWGHHLPRASWGSGFGRALQPPDERIPFLIHWSWPLQGERPLGPLRAFIRHHGNLADSA
SRFGRHGRLFPSASATEAIQRYRWNLAEWFSRLPREERQFGPTFALDTVHVDPVIRESTP
DELLRPPAELALEHQPPQAGLPPLALSQLFNPDASGRRVQTVVLYGTVGTGKSTLVRKMV
LDWCYGRLPAFELLIPFSCEDLSSLGPAPVSLCQLVAQRYMPLKKVLPLMAAAGSHLLFV
LHGLERLNLDFRLAGTGLCSDPEQPEEPAAIIVNLLRKYMLPEASILVTTRPSAIGRIPS
KYVGRYGEICGFSDTNLQKLYFQLRLNQPDCGCGSGVSAAPAQRDNLVQMLSRNLEGHHQ
IAAACFLPSYCWLVCATLHFLHAPTPAGQTLTSIYTSFLRLNFSGETLDSTDASNLSLMA
YAARTMGKLAYEGVSSRKTYFSEEDVCGCLEAGIKTEEEFQLLHIFRRDALRFFLAPCVE
PGRAGTFVFTVPAMQEYLAALYIVLGLRKTTLQKVGKEVAELVGRVGEDVSLVLGIMAKL
LPLRALPLLFNLIKVVPRVFGRMVGKSREAVAQAMVLEMFREEDYYNDDVLDQMGASILG
VEGPRRHPDEPPEDEVFELFPIFMGGLLSAHNRAVLAQLGCPIKNLDALENAQAIKKKLG
KLGRQVLPPSELLDHLFFHYEFQNQRFSAEVLSSLRQLNLAGVRMTPVKCTVVASVLGSG
RHALDEVNLASCQLDPAGLRTLMPVLLRARKLGLQLNSLGPEACKDLRDLLLHDQCQITT
LRLSNNPLMAAGVALLMEGLAGNTSVTHLSLLHTGLGDEGLELLAAQLDRNRQLQELNVA
YNGAGDTAALALARAAREHPSLELLHLYFNELSSEGRQVLRDLGGAAEGGARVVVSLTEG
TAVSEYWSVILSEVQRNLNSWDRARVQRHLELLLRDLEDSRGATLNPWRKAQLLRVEGEV
RGLLEQLGGSGS
NT seq 2919 nt   +upstreamnt  +downstreamnt
atgaggtggggccaccatttgcccagggcctcttggggctctggttttggaagagcactc
cagccaccagatgaacgtatccccttcctgatccactggagttggccccttcaaggggag
cgtccccttgggccccttagggcctttatacgccaccatggaaacttggcagacagtgct
tcccggttcgggaggcatggacggctgttccccagcgcctctgcaaccgaagccatacag
cggtaccgctggaacctggctgagtggttcagcaggctgcccagggaggagcgccagttt
ggcccgacttttgccctagacacagtccacgttgatcctgtgatccgcgagagcaccccc
gatgagctacttcgcccacccgcagagctggccctggagcatcagccaccccaggctggg
ctccccccactggccctgtctcagctctttaacccggatgcctctgggcgccgggtgcag
acagtggtgctgtatgggacagtgggcacaggcaagagcacgctggtgcgcaagatggtt
ctggactggtgttacgggcggctgccggccttcgagctgctcatccccttctcctgtgag
gacctgtcatccctgggccctgccccagtctccttgtgccaacttgtggcccagcgctac
atgcccctgaagaaggttctgcccctgatggctgccgctgggtcccacctcctctttgtg
ctccatggcttagagcgtctcaacctcgacttccgactggcaggcacaggactttgcagt
gacccggagcaaccagaggaaccagctgctatcatcgtcaacttgctgcgcaaatacatg
ctgcctgaggccagcattctagtgaccactcggccctctgccattggccgtatccccagc
aagtacgtgggccgctatggtgagatctgtggtttctctgataccaacctgcagaagctc
tacttccagctccgcctcaaccagccagactgcgggtgcggttcaggtgtctccgctgca
ccagctcagcgtgacaacctggtgcagatgctctcccggaacctggaggggcaccaccag
atcgccgctgcctgtttcctgccgtcctattgctggctcgtctgtgccaccttgcatttc
ctgcatgcccccacgcctgctgggcagacccttacaagtatctacaccagcttcctgcgc
ctcaacttcagcggggaaaccctggacagcactgacgcctccaatttgtccctgatggcc
tatgcagcccgaaccatgggcaagttggcctatgagggggtgtcctcccgcaagacctac
ttctctgaagaggatgtctgtggctgcctggaggctggcatcaagacggaggaggagttt
cagctgctgcacatcttccgccgggatgccctgaggtttttcctggccccatgtgtggag
ccggggcgtgcgggaaccttcgtgttcaccgtgcctgccatgcaggaatacctggccgcc
ctctacattgtgctgggtttgcgcaagacgaccctgcaaaaggtgggcaaggaagtggct
gagctcgtgggccgtgtgggggaggacgtcagcctggtactgggcatcatggccaagctg
ctgcctctgcgggctctgcctctgctcttcaacctgatcaaggtggttccacgagtgttt
gggcgcatggtgggtaaaagccgggaggcggtggcccaggccatggtgctggagatgttc
cgagaggaggactattacaatgatgatgttctggaccagatgggcgccagtatcctaggc
gtggagggcccccggcgccacccagatgagcctcctgaggatgaagtcttcgagctcttc
cccatattcatgggggggcttctctctgcccacaaccgagctgtgctagctcagcttggc
tgccccatcaagaacctggatgccctggagaatgcccaggccatcaagaagaagctgggc
aagctgggccggcaggtgctacccccgtcggagctccttgaccacctcttcttccactac
gagttccagaaccagcgcttctccgccgaggtgctcagctcccttcgtcagctcaacttg
gcaggtgtgcgtatgacacccgtcaagtgcacagtggtggcatctgtgctgggcagcgga
aggcatgccctggatgaggtgaatttggcctcctgccagctagaccctgctgggctgcgc
acactcatgcctgtcttactgcgtgcccggaaactgggcttgcaactcaacagcctgggc
cctgaggcctgcaaggacctccgagacctgctgctacatgaccagtgccaaattaccaca
ctgcggctgtccaacaacccgctgatggcggcaggtgttgccctgctgatggaggggctg
gcaggaaacacctcagtgacacacctgtccctgctgcacaccggccttggggacgaaggt
ctggagctgctggctgcccagctggatcgcaaccggcagctgcaggagctgaacgtggct
tacaatggtgctggtgacacagcggccctggccctggccagagctgcccgggagcaccct
tccctggaactgctgcacctctacttcaatgagctgagctcagagggccgccaggtcttg
cgagacttggggggtgctgctgaaggtggtgcccgggtggtggtgtcactgacagagggg
acggcggtgtcggaatactggtcagtgatcctcagcgaagtccagcggaacctcaacagc
tgggaccgggcccgggtccagcgacacctggagctcctcctgcgggatctggaagatagc
cggggtgctacccttaatccttggcgcaaggcccagctgctgcgagtggagggcgaggtg
aggggcctcctagagcagctgggaggctctggaagctga

DBGET integrated database retrieval system