KEGG   Macaca mulatta (rhesus monkey): 703982
Entry
703982            CDS       T01028                                 

Gene name
PFN3
Definition
(RefSeq) profilin-3
  KO
K05759  profilin
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04015  Rap1 signaling pathway
mcc04810  Regulation of actin cytoskeleton
mcc05014  Amyotrophic lateral sclerosis
mcc05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    703982 (PFN3)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    703982 (PFN3)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    703982 (PFN3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    703982 (PFN3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mcc04131]
    703982 (PFN3)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mcc04812]
    703982 (PFN3)
   04147 Exosome [BR:mcc04147]
    703982 (PFN3)
Membrane trafficking [BR:mcc04131]
 Others
  Actin-binding proteins
   Others
    703982 (PFN3)
Cytoskeleton proteins [BR:mcc04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Profilin
     703982 (PFN3)
Exosome [BR:mcc04147]
 Exosomal proteins
  Proteins found in most exosomes
   703982 (PFN3)
SSDB
Motif
Pfam: Profilin
Other DBs
NCBI-GeneID: 703982
NCBI-ProteinID: XP_001086728
Ensembl: ENSMMUG00000048792
UniProt: A0A1D5QCM9
LinkDB
Position
6
AA seq 137 aa
MGDWKVYISAVLRDQRIDDVAIVGHADNSCVWASRPGGLLAAISPQEVGVLTGPDRCTFL
QAGLSVGGRRCCVIRDHLLAEGDGVLDARTKGLDPRAVCVGHAPRALLVLMGRRGVHGGI
LNKTVHELIRGLRMQGA
NT seq 414 nt   +upstreamnt  +downstreamnt
atgggcgactggaaggtctacatcagtgcagtgttgcgggaccagcgcatcgacgacgtg
gccatcgtgggccatgcggataacagctgcgtgtgggcttcgcggcccgggggcctgctg
gctgccatctcgccgcaggaggtgggcgtgctcacggggcccgaccgttgcaccttcctg
caggcgggcctgagcgtgggcggccgccgctgctgcgtcatccgcgaccacctgctggcc
gagggcgacggcgtgctggacgcacgcaccaagggactggacccgcgcgccgtgtgcgtg
ggccacgcgccgcgcgcgctcctggtgctcatgggccgacgcggcgtccatgggggcatc
ctcaacaagacggtgcacgaactcatacgcgggctgcgcatgcagggcgcctag

KEGG   Macaca mulatta (rhesus monkey): 704416
Entry
704416            CDS       T01028                                 

Gene name
PFN4
Definition
(RefSeq) profilin-4
  KO
K05759  profilin
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04015  Rap1 signaling pathway
mcc04810  Regulation of actin cytoskeleton
mcc05014  Amyotrophic lateral sclerosis
mcc05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    704416 (PFN4)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    704416 (PFN4)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    704416 (PFN4)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    704416 (PFN4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mcc04131]
    704416 (PFN4)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mcc04812]
    704416 (PFN4)
   04147 Exosome [BR:mcc04147]
    704416 (PFN4)
Membrane trafficking [BR:mcc04131]
 Others
  Actin-binding proteins
   Others
    704416 (PFN4)
Cytoskeleton proteins [BR:mcc04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Profilin
     704416 (PFN4)
Exosome [BR:mcc04147]
 Exosomal proteins
  Proteins found in most exosomes
   704416 (PFN4)
SSDB
Motif
Pfam: Profilin
Other DBs
NCBI-GeneID: 704416
NCBI-ProteinID: XP_001099519
Ensembl: ENSMMUG00000009405
UniProt: G7N9I8 F6XA76
LinkDB
Position
13
AA seq 129 aa
MSHLQSLLLDTLLGTKHVDSAALIKIQERSLCVASPGFNVMPSDVRTLVNGFAKNPLQTR
REGLYFKEKDYRCVRADEYSLYAKNENAGVVVVKTHLYLLVATYTEGMYPSVCVEATESL
GDYLRKKGS
NT seq 390 nt   +upstreamnt  +downstreamnt
atgagccatttgcagagcttattgttagacaccctcttgggaaccaagcatgtggacagt
gcagccctcatcaaaatccaggagcggagcctgtgtgtagcatcaccaggttttaatgta
atgcccagtgatgtccgaacactggtgaatggatttgccaagaaccctttgcaaacccga
agagaaggattgtatttcaaggaaaaggattacagatgtgtccgggcagatgaatattct
ctttatgccaaaaatgagaacgctggtgtggttgtggtgaagacccatctgtatcttctg
gtggcaacttacactgagggcatgtatcctagcgtctgtgtggaagccacagagagcctg
ggagactacctaagaaaaaaaggaagttga

KEGG   Macaca mulatta (rhesus monkey): 710753
Entry
710753            CDS       T01028                                 

Gene name
PFN1
Definition
(RefSeq) profilin-1
  KO
K05759  profilin
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04015  Rap1 signaling pathway
mcc04810  Regulation of actin cytoskeleton
mcc05014  Amyotrophic lateral sclerosis
mcc05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    710753 (PFN1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    710753 (PFN1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    710753 (PFN1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    710753 (PFN1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mcc04131]
    710753 (PFN1)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mcc04812]
    710753 (PFN1)
   04147 Exosome [BR:mcc04147]
    710753 (PFN1)
Membrane trafficking [BR:mcc04131]
 Others
  Actin-binding proteins
   Others
    710753 (PFN1)
Cytoskeleton proteins [BR:mcc04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Profilin
     710753 (PFN1)
Exosome [BR:mcc04147]
 Exosomal proteins
  Proteins found in most exosomes
   710753 (PFN1)
SSDB
Motif
Pfam: Profilin
Other DBs
NCBI-GeneID: 710753
NCBI-ProteinID: XP_014973845
Ensembl: ENSMMUG00000002772
UniProt: F7H2A5
LinkDB
Position
16
AA seq 140 aa
MAGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGVLVGKDRSSFY
VNGLTLGGQKCSVIRDSLLQDGEFSMDLRTKSTGGAPTFNVTVTKTDKTLVLLMGKEGVH
GGLINKKCYEMASHLRRSQY
NT seq 423 nt   +upstreamnt  +downstreamnt
atggccgggtggaacgcctacatcgacaacctcatggcggacgggacctgtcaggacgcg
gccatcgtgggttacaaggactcgccctccgtctgggccgccgtccccgggaaaaccttc
gtcaacatcacgccagctgaggtgggtgtcctggttggcaaagaccggtcaagtttttac
gtcaatgggctgacacttgggggccagaaatgttcggtgatccgggactcactgctgcag
gatggggagtttagcatggatcttcgtaccaagagcaccggtggggcccccaccttcaat
gtcactgtcaccaagactgacaagacgctagtcctgctgatgggcaaagaaggtgtccac
ggtggtttgatcaacaagaaatgttatgaaatggcctcccaccttcggcgctcccagtac
tga

KEGG   Macaca mulatta (rhesus monkey): 713460
Entry
713460            CDS       T01028                                 

Gene name
PFN2
Definition
(RefSeq) profilin-2 isoform X1
  KO
K05759  profilin
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04015  Rap1 signaling pathway
mcc04810  Regulation of actin cytoskeleton
mcc05014  Amyotrophic lateral sclerosis
mcc05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    713460 (PFN2)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    713460 (PFN2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    713460 (PFN2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    713460 (PFN2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mcc04131]
    713460 (PFN2)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mcc04812]
    713460 (PFN2)
   04147 Exosome [BR:mcc04147]
    713460 (PFN2)
Membrane trafficking [BR:mcc04131]
 Others
  Actin-binding proteins
   Others
    713460 (PFN2)
Cytoskeleton proteins [BR:mcc04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Profilin
     713460 (PFN2)
Exosome [BR:mcc04147]
 Exosomal proteins
  Proteins found in most exosomes
   713460 (PFN2)
SSDB
Motif
Pfam: Profilin
Other DBs
NCBI-GeneID: 713460
NCBI-ProteinID: XP_014987280
Ensembl: ENSMMUG00000023337
LinkDB
Position
2
AA seq 156 aa
MAGWQSYVDNLMCDGCCQEAAIVGYCDAKYVWAATAGGVFQSITPIEIDMIVGKDREGFF
TNGLTLGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGRDVKSNKQQREYQ
EEFLHYCGFFCVEMSYDFRFGGCVGRLKSANWGPPT
NT seq 471 nt   +upstreamnt  +downstreamnt
atggccggttggcagagctacgtggataacctgatgtgcgatggctgctgccaggaggcc
gccattgtcggctactgcgacgccaaatacgtctgggcagccacggccgggggcgtcttt
cagagcattacgccaatagaaatagatatgattgtaggaaaagaccgggaaggtttcttt
accaacggtttgactcttggcgcgaagaaatgctcagtgatcagagatagtctatacgtc
gatggtgactgcacaatggacatccggacaaagagtcaaggtggggagccaacatacaat
gttgctgtcggcagagctggtagagatgtgaaatctaataaacagcaaagggagtaccag
gaagagtttctgcactattgtggatttttctgtgttgaaatgtcgtatgactttagattt
ggaggctgtgttggcagactgaagtcagccaactggggccctcctacataa

DBGET integrated database retrieval system