KEGG   Macaca mulatta (rhesus monkey): 704331
Entry
704331            CDS       T01028                                 

Gene name
CREBBP
Definition
(RefSeq) CREB-binding protein
  KO
K04498  E1A/CREB-binding protein [EC:2.3.1.48]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04024  cAMP signaling pathway
mcc04066  HIF-1 signaling pathway
mcc04068  FoxO signaling pathway
mcc04110  Cell cycle
mcc04310  Wnt signaling pathway
mcc04330  Notch signaling pathway
mcc04350  TGF-beta signaling pathway
mcc04520  Adherens junction
mcc04630  JAK-STAT signaling pathway
mcc04720  Long-term potentiation
mcc04916  Melanogenesis
mcc04919  Thyroid hormone signaling pathway
mcc04922  Glucagon signaling pathway
mcc04935  Growth hormone synthesis, secretion and action
mcc05016  Huntington disease
mcc05152  Tuberculosis
mcc05161  Hepatitis B
mcc05164  Influenza A
mcc05165  Human papillomavirus infection
mcc05166  Human T-cell leukemia virus 1 infection
mcc05167  Kaposi sarcoma-associated herpesvirus infection
mcc05200  Pathways in cancer
mcc05203  Viral carcinogenesis
mcc05206  MicroRNAs in cancer
mcc05211  Renal cell carcinoma
mcc05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    704331 (CREBBP)
   04330 Notch signaling pathway
    704331 (CREBBP)
   04350 TGF-beta signaling pathway
    704331 (CREBBP)
   04630 JAK-STAT signaling pathway
    704331 (CREBBP)
   04066 HIF-1 signaling pathway
    704331 (CREBBP)
   04068 FoxO signaling pathway
    704331 (CREBBP)
   04024 cAMP signaling pathway
    704331 (CREBBP)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    704331 (CREBBP)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    704331 (CREBBP)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    704331 (CREBBP)
   04935 Growth hormone synthesis, secretion and action
    704331 (CREBBP)
   04919 Thyroid hormone signaling pathway
    704331 (CREBBP)
   04916 Melanogenesis
    704331 (CREBBP)
  09156 Nervous system
   04720 Long-term potentiation
    704331 (CREBBP)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    704331 (CREBBP)
   05206 MicroRNAs in cancer
    704331 (CREBBP)
   05203 Viral carcinogenesis
    704331 (CREBBP)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    704331 (CREBBP)
   05215 Prostate cancer
    704331 (CREBBP)
  09164 Neurodegenerative disease
   05016 Huntington disease
    704331 (CREBBP)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    704331 (CREBBP)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    704331 (CREBBP)
   05161 Hepatitis B
    704331 (CREBBP)
   05164 Influenza A
    704331 (CREBBP)
   05167 Kaposi sarcoma-associated herpesvirus infection
    704331 (CREBBP)
   05165 Human papillomavirus infection
    704331 (CREBBP)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mcc03000]
    704331 (CREBBP)
   03036 Chromosome and associated proteins [BR:mcc03036]
    704331 (CREBBP)
   03029 Mitochondrial biogenesis [BR:mcc03029]
    704331 (CREBBP)
Enzymes [BR:mcc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     704331 (CREBBP)
Transcription factors [BR:mcc03000]
 Eukaryotic type
  Other transcription factors
   Pocket domain CBP
    704331 (CREBBP)
Chromosome and associated proteins [BR:mcc03036]
 Eukaryotic type
  Histone modification proteins
   HATs (histone acetyltransferases)
    704331 (CREBBP)
Mitochondrial biogenesis [BR:mcc03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    704331 (CREBBP)
SSDB
Motif
Pfam: HAT_KAT11 KIX Creb_binding zf-TAZ DUF902 Bromodomain ZZ KIX_2 Npa1
Other DBs
NCBI-GeneID: 704331
NCBI-ProteinID: NP_001247644
Ensembl: ENSMMUG00000002286
UniProt: A0A5F7ZKK8
LinkDB
Position
20
AA seq 2442 aa
MAENLLDGPPNPKRAKLSSPGFSANDSTDFGSLFDLENDLPDELIPNGGELGLLNSGNLV
PDAASKHKQLSELLRGGSGSSINPGIGNVSASSPVQQGLGGQAQGQPNSANMASLGAMGK
SPLSQGDSSAPSLPKQAASTSGPTPAASQALNPQAQKQVGLATSSPATSQTGPGICMNAN
FNQTHPGLLNSNSGHSLMNQASQGQAQVMNGSLGAAGRGRGAGMPYPTPAMQGATSSVLA
ETLTQVSPQMTGHAGLNTAQAGGMAKMGITGNTSPFGQPFSQAGGQPMGATGVNPQLASK
QSMVNSLPTFPTDIKNTSVTNVPNMSQMQTSVGIVPTQGIATGPTADPEKRKLIQQQLVL
LLHAHKCQRREQANGEVRACSLPHCRTMKNVLNHMTHCQAGKACQVAHCASSRQIISHWK
NCTRHDCPVCLPLKNASDKRNQQTILGSPASGIQNTIGSVGTGQQNATSLSNPNPIDPSS
MQRAYAALGLPYMNQPQTQLQPQVPGQQPAQPQTHQQMRTLNPLGNNPMNIPAGGITTDQ
QPPNLISESALPTSLGATNPLMNDGSNSGNIGTLSTIPTAAPPSSTGVRKGWHEHVTQDL
RSHLVHKLVQAIFPTPDPAALKDRRMENLVAYAKKVEGDMYESANSRDEYYHLLAEKIYK
IQKELEEKRRSRLHKQGILGNQPALPAPGTQPPVIPQAQPVRPPNGPLSLPVNRMQVSQG
MNSFNPMSLGNVQLPQAPMGPRAASPMNHSVQMNSMGSVPGMAISPSRMPQPPNMMGAHS
NNMMAQAPAQSQFLPQNQFPPSSGAMSVGMGQPPAQTGVSQGQVPGAALPNPLNMLGPQA
SQLPCPPVTQSPLHPTPPPASTAAGMPSLQHTTPPGMTPPQPAAATQPSTPVSSSGQTPT
PTPGSVPSATQTQSTPTVQAAAQAQVTPQPQTPVQPPSVATPQSSQQQPTPVHAQPPGTP
LSQAAASIDNRVPTPSSVASAETNSQQPGPDVPVLEMKVETQTEDTEPDPGESKGEPRSE
MMEEDLQGASQVKEETDTAEQKSEPMEVDEKKPEVKVEVKEEEESSTNGTASQSTSPSQP
RKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKR
KLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSLGYCC
GRKYEFSPQTLCCYGKQLCTIPRDAAYYSYQNRYHFCEKCFTEIQGENVTLGDDPSQPQT
TISKDQFEKKKNDTLDPEPFVDCKECGRKMHQICVLHYDIIWPSGFVCDNCLKKTGRPRK
ENKFSAKRLQTTRLGNHLEDRVNKFLRRQNHPEAGEVFVRVVASSDKTVEVKPGMKSRFV
DSGEMSESFPYRTKALFAFEEIDGVDVCFFGMHVQEYGSDCPPPNTRRVYISYLDSIHFF
RPRCLRTAVYHEILIGYLEYVKKLGYVTGHIWACPPSEGDDYIFHCHPPDQKIPKPKRLQ
EWYKKMLDKAFAERIIHDYKDIFKQATEDRLTSAKELPYFEGDFWPNVLEESIKELEQEE
EERKKEESTAASETTEGSQGDSKNAKKKNNKKTNKNKSSISRANKKKPSMPNVSNDLSQK
LYATMEKHKEVFFVIHLHAGPVINTLPPIVDPDPLLSCDLMDGRDAFLTLARDKHWEFSS
LRRSKWSTLCMLVELHTQGQDRFVYTCNECKHHVETRWHCTVCEDYDLCINCYNTKSHAH
KMVKWGLGLDDEGSSQGEPQSKSPQESRRLSIQRCIQSLVHACQCRNANCSLPSCQKMKR
VVQHTKGCKRKTNGGCPVCKQLIALCCYHAKHCQENKCPVPFCLNIKHKLRQQQIQHRLQ
QAQLMRRRMATMNTRNVPQQSLPSPTSAPPGTPTQQPSTPQTPQPPAQPQPSPVSMSPAG
FPSVARTQPPTTVSTGKPTSQVPAPPPPAQPPPAAVEAARQIEREAQQQQHLYRVNINNG
MPPGRTGMGTPGSQMAPVSLNVPRPNQVSGPVMPSMPPGQWQQAPLPQQQPMPGLPRPVI
SMQAQAAVAGPRMPSVQPPRSISPSALQDLLRTLKSPSSPQQQQQVLNILKSNPQLMAAF
IKQRTAKYVANQPGMQPQPGLQSQPGMQPQPGMHQQPSLQNLNAMQAGVPRPGVPPQQQA
MGGLNPQGQALNIMNPGHNPNMASMNPQYREMLRRQLLQQQQQQQQQQQQQQQQQQGSAG
MAGGMAGHGQFQQPQGPGGYPPAMQQQQRMQQHLPLQGSSMGQMAAQMGQLGQMGQPGLG
ADSTPNIQQALQQRILQQQQMKQQIGSPGQPNPMSPQQHMLSGQPQASHLPGQQIATSLS
NQVRSPAPVQSPRPQSQPPHSSPSPRIQPQPSPHHVSPQTGSPHPGLAVTMASSIDQGHL
GNPEQSAMLPQLNTPSRSALSSELSLVGDTTGDTLEKFVEGL
NT seq 7329 nt   +upstreamnt  +downstreamnt
atggccgagaacttgctggacggaccgcccaaccccaaacgagccaaactcagctcgccc
ggcttctcggcgaatgacagcacagattttggatcattgtttgacttggaaaatgatctt
cctgatgagctgatacccaatggaggagaattaggccttttaaacagtgggaaccttgtt
ccagatgctgcttccaaacataaacaactgtcggagcttctacgaggaggcagcggctct
agtatcaacccaggaataggaaatgtgagcgccagcagccccgtgcagcagggcctgggt
ggccaggctcaagggcagccgaacagtgcaaacatggccagcctcggtgccatgggcaag
agccctctgagccagggagattcttcagcccccagcctgcccaaacaggcagccagcacc
tctgggcccacccccgctgcctcccaagcactgaatccacaagcacaaaagcaagtgggg
ctggcgactagcagccctgccacgtcacagactggacctggtatctgcatgaatgctaac
tttaaccagacccacccgggcctcctcaatagtaactctggccatagcttaatgaatcag
gcttcacaagggcaggcgcaagtcatgaatggatctctcggggctgctggcagaggaagg
ggagctggaatgccataccctactccagccatgcagggcgccacgagcagcgtgctggct
gagaccctaacgcaggtttccccgcaaatgactggtcacgcgggactgaacaccgcacag
gcaggaggcatggccaagatgggaataactgggaacacaagtccatttggacagcccttt
agtcaagctggagggcagccaatgggagccactggagtgaacccccagttagccagcaaa
cagagcatggtcaacagtttacccaccttccctacagacatcaagaatacttcagtcacc
aacgtgccaaatatgtctcagatgcaaacatcagtgggaattgtacccacacaaggaatt
gcaacgggccccactgcagatcctgaaaaacgcaaactgatacagcagcagctggttcta
ctgcttcatgctcataagtgtcagagacgagagcaagcaaacggagaggttcgggcctgc
tcgctcccacattgtcgaaccatgaaaaacgttttgaatcacatgacgcattgtcaggct
gggaaagcctgccaagttgcccattgtgcatcttcacgacaaatcatctctcattggaag
aactgcacacgacatgactgtcctgtttgcctccctttgaaaaatgccagtgacaagcga
aaccaacaaaccatcctggggtctccagctagtggaattcaaaacacaattggttctgtt
ggcacagggcaacagaatgccacttctttaagtaacccaaatcccatagaccccagctcc
atgcagcgagcctatgctgctctcggactcccctacatgaaccagccccagacgcagctg
cagcctcaggttcctggccagcaaccagcacagcctcaaacccaccagcagatgaggact
ctcaaccccctgggaaataatccaatgaacattccagcaggaggaataacaacagatcag
cagcccccaaacttgatttcagaatcagctcttccgacttccttgggggccacaaaccca
ctgatgaacgatggctccaactctggtaacattggaaccctcagcactataccaacagca
gctcctccttccagcactggtgtaaggaaaggctggcacgaacatgtcactcaggacctg
cggagccatctagtgcataaactcgtccaagccatcttcccaacacctgatcccgcagct
ctaaaggatcgccgcatggaaaacctggtagcctatgctaagaaagtggaaggggacatg
tacgagtctgccaacagcagggatgaatattatcacttattagcagagaaaatctacaag
atacaaaaagaactagaagaaaaacggaggtcgcgtttacataaacaaggcatcttgggg
aaccagccagccttaccagccccggggactcagccccctgtgattccacaggcacaacct
gtgagacctccaaatggacctctgtccctgccagtgaatcgcatgcaagtttctcaaggg
atgaattcgtttaaccccatgtccttggggaacgtccagttgccacaagcacccatggga
cctcgtgcagcctccccaatgaaccactctgtccagatgaacagcatgggctcagtgcca
gggatggccatttctccttcccgaatgcctcagcctccaaacatgatgggtgcacacagc
aacaacatgatggcccaggcgcctgctcagagccagtttctgccacagaaccagttcccg
ccatccagcggggcgatgagtgtgggcatggggcagccgccagcccaaacaggcgtgtca
cagggacaggtgcctggtgctgctcttcctaaccctctcaacatgctagggcctcaggcc
agccagctgccttgccctccagtgacacagtcaccattgcacccaacaccgcctcctgct
tccacggctgctggcatgccatctctccagcacacgacaccacctgggatgactcctccc
cagccagcagctgccactcagccatcaactcctgtgtcatcttctgggcagactcccacc
ccgactcctggctcagtgcccagtgctacgcaaacgcagagcacccctacagtccaagca
gcagcccaggcccaggtgaccccacaacctcaaaccccagttcagcccccgtctgtggct
acccctcagtcgtcgcagcaacagccgacgcctgtgcacgcccagcctcctggcacaccg
ctttcccaggcagcagccagcattgataacagggtccctaccccctcctcggtggccagt
gcagaaaccaattcccagcagccaggacctgacgtacctgtgctggaaatgaaggtggag
acccagacggaggacactgagcccgatcctggtgaatccaaaggggagcccaggtctgag
atgatggaggaggatttgcaaggagcttcccaagttaaagaagaaacagacacagcagag
cagaaatcagaaccaatggaagtggatgaaaagaaacctgaagtgaaagtagaagttaaa
gaggaagaagagagtagcactaacggcacagcctctcagtcaacatctccttcgcagcca
cgcaaaaaaatctttaaaccagaggagttacgccaggccctgatgccgaccctagaagca
ctgtatcgacaggacccagagtcattacctttccggcagcctgtagatccccagctcctt
ggaattccagattattttgacatcgtaaagaatcccatggacctctccaccatcaagcgg
aagctggacacagggcagtaccaagagccctggcagtacgtggacgacgtctggctcatg
ttcaacaatgcctggctctataatcgcaagacatcccgagtctataagttttgcagtaag
cttgcagaggtctttgagcaggaaattgacccggtcatgcagtcccttggatattgctgt
ggacgcaagtatgagttttccccacagactttgtgctgctatgggaagcagctgtgtacc
attcctcgcgatgctgcctactacagctatcagaataggtatcatttctgtgagaagtgt
ttcacagagatccagggcgagaatgtgaccctgggtgacgacccttcacagccccagacg
acaatttcaaaggatcagtttgaaaagaagaaaaatgataccttagaccccgaacctttc
gttgattgcaaggagtgtggccggaagatgcatcagatttgtgttctgcactatgatatc
atttggccttcaggttttgtgtgcgacaactgcttgaagaaaactggcagacctcgaaaa
gaaaacaaattcagtgctaagaggctacagaccacgagactgggaaaccacttggaagac
cgagtgaacaaatttttgcggcgccagaatcaccctgaagccggggaggtttttgtccga
gtggtggccagctcagacaagacggtggaggtcaagcccgggatgaagtcacggtttgtg
gattctggggagatgtctgaatctttcccatatcgaaccaaagcgctgtttgcttttgag
gaaattgacggcgtggatgtctgcttttttggaatgcacgttcaagaatacggctctgat
tgcccccctccaaacacgaggcgtgtgtacatttcttatctggatagtattcatttcttc
cggccacgttgcctccgcacagctgtttaccatgagatccttattggatatctagagtat
gtgaagaaattggggtatgtgacagggcacatctgggcctgtcctccaagtgaaggagac
gattacatcttccattgccacccacctgatcaaaaaatacccaagccaaaacgactgcag
gagtggtacaaaaagatgctggacaaggcgttcgcagagcggatcattcatgactacaag
gatattttcaaacaagcaactgaagataggctcaccagtgccaaggaactgccctatttt
gaaggtgatttctggcccaatgtgttagaagagagcattaaggaactagaacaagaagaa
gaggagaggaaaaaggaagagagcactgcagccagtgaaaccactgagggcagtcagggt
gacagcaagaatgccaagaagaagaataacaagaaaactaacaagaacaaaagcagcatc
agccgcgccaataagaagaagcccagcatgcccaacgtgtccaatgacctgtcccagaag
ctgtatgccaccatggagaagcacaaggaggtcttctttgtgatccacctgcacgccggg
cctgtcatcaacaccctgccccccatcgtcgaccccgaccccctgctcagctgtgacctc
atggatgggcgcgatgccttcctcacccttgccagagacaagcactgggagttctcctcc
ttgcgccgctccaagtggtccacgctctgcatgctggtggagctgcacacccagggccag
gaccgctttgtctacacctgcaatgagtgcaagcaccacgtggagacacgctggcactgc
actgtgtgcgaggactacgacctctgcatcaactgctataacacgaagagccatgcccat
aagatggtgaagtgggggctgggcctggacgacgagggcagcagccagggcgagccacag
tcaaagagcccccaggagtcgcgccggctgagcatccagcgctgcatccagtcactggtg
catgcgtgccagtgccgcaacgccaactgctcgctgccatcctgccagaagatgaagcgg
gtggtgcagcacaccaagggctgcaagcgcaagaccaatgggggctgcccggtgtgcaag
cagctcatcgccctctgctgctaccacgccaagcactgccaagaaaacaaatgccccgtg
cccttctgcctcaacattaaacacaagctccgccagcagcagatccagcaccgcctgcag
caggcccagctcatgcgccggcggatggccaccatgaacacccgcaacgtgcctcagcag
agtctgccttctcctacctcagcaccgcccgggacccccacgcaacagcccagcacgccc
cagacgccgcagccccccgcccagccccaaccctcacccgtgagcatgtcaccagctggc
ttccccagcgtggcccggactcagccccccaccacggtgtccacagggaagcctaccagc
caggtgccggcccccccgcccccggcccagccccctcctgcagcggtggaagcggctcgg
cagatcgagcgtgaggcccagcagcagcagcatctgtaccgggtgaacatcaacaacggc
atgcccccagggcgcacgggcatggggaccccggggagccagatggcccccgtgagtctg
aatgtgccccgacccaaccaggtgagcgggcccgtcatgcccagcatgcctcccgggcag
tggcagcaggcaccccttccccagcagcagcccatgccaggcttgcccaggcctgtgata
tccatgcaggcccaggcggccgtggctgggccccggatgcccagcgtgcagccgcccagg
agcatctcacccagcgctctccaagacctgctgcggaccctgaagtcgcccagctcccct
cagcagcaacagcaggtgctgaacattctcaaatcaaacccgcagctaatggcagctttt
attaaacagcgcacagccaagtacgtggccaatcagcctggcatgcagccccagcctggc
ctccagtcccagcccggcatgcaaccccagcctggcatgcaccagcagcccagcctgcag
aacctgaatgccatgcaggctggtgtgccgcggcccggtgtgcctccacagcagcaggcg
atgggaggcctgaacccccagggccaggccttgaacatcatgaacccaggacacaacccc
aacatggcgagtatgaatccacagtaccgagaaatgctacggaggcagttgctgcagcag
cagcagcagcagcagcagcaacagcagcaacagcagcagcagcagcaagggagtgccggc
atggctgggggcatggcggggcacggccagttccagcagcctcaaggacccggaggctac
ccaccagccatgcagcagcagcagcgcatgcagcagcatctgcccctccagggcagctcc
atgggccagatggcggctcagatgggacagcttggccagatggggcagccggggctgggg
gcagacagcacccccaacatccagcaagccctgcagcagcggattctgcagcaacagcag
atgaagcagcagattgggtccccaggccagccaaaccccatgagcccccagcaacacatg
ctctcaggacagccacaggcctcgcatctccctggccagcagatcgccacatcccttagt
aaccaggtgcggtctccagcccctgtccagtctccacggccccagtcccagcctccacat
tccagcccatcaccacggatacagccccagccttcgccacaccacgtctcaccccagact
ggttccccccaccccggacttgcagtcaccatggccagctccatagatcagggacacttg
gggaaccccgaacagagtgcaatgctcccccagctgaacacccccagcaggagcgcgctg
tccagcgaactgtccctggtcggggacaccacgggggacacgctagagaagtttgtggag
ggcttgtag

KEGG   Macaca mulatta (rhesus monkey): 706258
Entry
706258            CDS       T01028                                 

Gene name
EP300
Definition
(RefSeq) histone acetyltransferase p300
  KO
K04498  E1A/CREB-binding protein [EC:2.3.1.48]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04024  cAMP signaling pathway
mcc04066  HIF-1 signaling pathway
mcc04068  FoxO signaling pathway
mcc04110  Cell cycle
mcc04310  Wnt signaling pathway
mcc04330  Notch signaling pathway
mcc04350  TGF-beta signaling pathway
mcc04520  Adherens junction
mcc04630  JAK-STAT signaling pathway
mcc04720  Long-term potentiation
mcc04916  Melanogenesis
mcc04919  Thyroid hormone signaling pathway
mcc04922  Glucagon signaling pathway
mcc04935  Growth hormone synthesis, secretion and action
mcc05016  Huntington disease
mcc05152  Tuberculosis
mcc05161  Hepatitis B
mcc05164  Influenza A
mcc05165  Human papillomavirus infection
mcc05166  Human T-cell leukemia virus 1 infection
mcc05167  Kaposi sarcoma-associated herpesvirus infection
mcc05200  Pathways in cancer
mcc05203  Viral carcinogenesis
mcc05206  MicroRNAs in cancer
mcc05211  Renal cell carcinoma
mcc05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    706258 (EP300)
   04330 Notch signaling pathway
    706258 (EP300)
   04350 TGF-beta signaling pathway
    706258 (EP300)
   04630 JAK-STAT signaling pathway
    706258 (EP300)
   04066 HIF-1 signaling pathway
    706258 (EP300)
   04068 FoxO signaling pathway
    706258 (EP300)
   04024 cAMP signaling pathway
    706258 (EP300)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    706258 (EP300)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    706258 (EP300)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    706258 (EP300)
   04935 Growth hormone synthesis, secretion and action
    706258 (EP300)
   04919 Thyroid hormone signaling pathway
    706258 (EP300)
   04916 Melanogenesis
    706258 (EP300)
  09156 Nervous system
   04720 Long-term potentiation
    706258 (EP300)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    706258 (EP300)
   05206 MicroRNAs in cancer
    706258 (EP300)
   05203 Viral carcinogenesis
    706258 (EP300)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    706258 (EP300)
   05215 Prostate cancer
    706258 (EP300)
  09164 Neurodegenerative disease
   05016 Huntington disease
    706258 (EP300)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    706258 (EP300)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    706258 (EP300)
   05161 Hepatitis B
    706258 (EP300)
   05164 Influenza A
    706258 (EP300)
   05167 Kaposi sarcoma-associated herpesvirus infection
    706258 (EP300)
   05165 Human papillomavirus infection
    706258 (EP300)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mcc03000]
    706258 (EP300)
   03036 Chromosome and associated proteins [BR:mcc03036]
    706258 (EP300)
   03029 Mitochondrial biogenesis [BR:mcc03029]
    706258 (EP300)
Enzymes [BR:mcc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     706258 (EP300)
Transcription factors [BR:mcc03000]
 Eukaryotic type
  Other transcription factors
   Pocket domain CBP
    706258 (EP300)
Chromosome and associated proteins [BR:mcc03036]
 Eukaryotic type
  Histone modification proteins
   HATs (histone acetyltransferases)
    706258 (EP300)
Mitochondrial biogenesis [BR:mcc03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    706258 (EP300)
SSDB
Motif
Pfam: HAT_KAT11 KIX Creb_binding zf-TAZ DUF902 Bromodomain ZZ KIX_2 Npa1
Other DBs
NCBI-GeneID: 706258
NCBI-ProteinID: NP_001253415
Ensembl: ENSMMUG00000000893
UniProt: A0A5F8AFL2 G7N3Y2
LinkDB
Position
10
AA seq 2414 aa
MAENVVEPGPPSAKRPKLSSPALSASASDGTDFGSLFDLEHDLPDELINSTELGLTNGGD
INQLQTSLGIVQDAASKHKQLSELLRSGSSPNLNMGVGGPGQVMASQAQQNSPGLGLINS
MVKSPMTQAGLTSPNMGMGTSGPNQGPTQSTGMMNSPVNQPAMGMNTGMNAGMNPGMLAA
GNGQGIMPNQVMNGSIGAGRGRQNMQYPNPGMGSAGNLLTEPLQQGSPQMGGQTGLRGPQ
PLKMGMMNNPNPYGSPYTQNPGQQIGASGLGLQIQTKTVLSNNLSPFAMDKKTVPGGGMP
NMGQQPAPQVQQPGLVTPVAQGMGSGAHTADPEKRKLIQQQLVLLLHAHKCQRREQANGE
VRQCNLPHCRTMKNVLNHMTHCQSGKSCQVAHCASSRQIISHWKNCTRHDCPVCLPLKNA
GDKRNQQPILTGAPVGLGNPSSLGVGQQSTPNLSTVSQIDPSSIERAYAALGLPYQVNQM
PTQPQVQAKNQQNQQPGQSPQGMRPMSNMSASPMGVNGGVGVQTPSLLSDSMLHSAINSQ
NPMMSENASVPSLGPMPTAAQPSSTGIRKQWHEDITQDLRNHLVHKLVQAIFPTPDPAAL
KDRRMENLVAYARKVEGDMYESANNRAEYYHLLAEKIYKIQKELEEKRRTRLQKQNMLPN
AAGMVPVSMNPGPNMGQPQPGMTSNGPLPDPTMIRGSVPNQMMPRITPQSGLNQFGQMSM
AQPPIVPRQTAPLQHHGQLAQPGALNLPMGYGPRMQQPSNQSQFLPQTQFPSQGMNVTNM
PLAPSSGQAPVSQAQMSSSSCPVNSPIMPPGSQGSHIHCPQLPQPALHQNSPSPVPSRTP
TPHHTPPSIGAQQPPATTIPAPVPTPPAMPPGPQSQALHPPPRQTPTPPTTQLPQQVQPS
LPAAPSADQPQQQPRSQQSTAASVPTPTAPLLAPQPATPLSQPAVSIEGQVSNPPSTSST
EVNSQAIPEKQPSQEVKMEAKMEVDQPEPADTQPEDISESKVEDCKMEPTETEERSTELK
TEIKEEEDQPSTSATQSSPAPGQSKKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVD
PQLLGIPDYFDIVKSPMDLSTIKRKLDTGQYQEPWQYVDDIWLMFNNAWLYNRKTSRVYK
YCSKLSEVFEQEIDPVMQSLGYCCGRKLEFSPQTLCCYGKQLCTIPRDATYYSYQNRYHF
CEKCFNEIQGESVSLGDDPSQPQTTINKEQFSKRKNDTLDPELFVECTECGRKMHQICVL
HHEIIWPAGFVCDGCLKKSARTRKENKFSAKRLPSTRLGTFLENRVNDFLRRQNHPESGE
VTVRVVHASDKTVEVKPGMKARFVDSGEMAESFPYRTKALFAFEEIDGVDLCFFGMHVQE
YGSDCPPPNQRRVYISYLDSVHFFRPKCLRTAVYHEILIGYLEYVKKLGYTTGHIWACPP
SEGDDYIFHCHPPDQKIPKPKRLQEWYKKMLDKAVSERIVHDYKDIFKQATEDRLTSAKE
LPYFEGDFWPNVLEESIKELEQEEEERKREENTSNESTDVTKGDSKNAKKKNNKKTSKNK
SSLSRGNKKKPGMPNVSNDLSQKLYATMEKHKEVFFVIRLIAGPTANSLPPIVDPDPLIP
CDLMDGRDAFLTLARDKHLEFSSLRRAQWSTMCMLVELHTQSQDRFVYTCNECKHHVETR
WHCTVCEDYDLCITCYNTKNHDHKMEKLGLGLDDESNNQQAAATQSPGDSRRLSIQRCIQ
SLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPICKQLIALCCYHAKHCQENK
CPVPFCLNIKQKLRQQQLQHRLQQAQMLRRRMASMQRTGVVGQQQGLPSPTPATPTTPTG
QQPTTPQTPQPTSQPQPTPPNSMPPYLPRTQAAGPVSQGKAAGQVTPPTPPQTAQPPLPG
PPPAAVEMAMQIQRAAETQRQMAHVQIFQRPIQHQMPPMTPMAPMGMNPPPMTRGPSGHL
EPGMGPTGMQQQPPWGQGGLPQPQQLQSGMPRPAMMSVAQHGQPLNMAPQPGLGQVGVSP
LKPGTVSQQALQNLLRTLRSPSSPLQQQQVLSILHANPQLLAAFIKQRAAKYANSNPQPI
PGQPGMPQGQPGLQPPTMPGQQGVHSNPAMQNMNPMQAGVQRAGLPQQQPQQQLQPPMGG
MSPQSQQMNMNHNTMPSQFRDILRRQQMMQQQQQQGAGPGIGPGMANHNQFQQPQGVGYP
PQQQQRMQHHMQQMQQGNMGQMGQLPQALGAEAGASLQAYQQRLLQQQMGSPAQPNPMSP
QQHMLPNQAQSPHLQGQQIPNSLSNQVRSPQPVPSPRPQSQPPHSSPSPRMQPQPSPHHV
SPQTSSPHPGLVAAQANPMEQGHFASPDQNSMLSQLASNPGMANLHGASATDLGLSTDNS
DLNSNLSQSTLDIH
NT seq 7245 nt   +upstreamnt  +downstreamnt
atggccgagaatgtggtggaaccggggccgccttcagccaagcggcctaaactctcatct
ccggccctctcggcgtccgccagcgatggcacagattttggctctctgtttgacttggag
cacgacttaccagatgaattaatcaactctacagaattgggactaaccaatggtggtgat
attaatcagcttcagacaagtcttggcatagtacaagatgcagcttctaaacataaacag
ctatcagaattgctgcgatctggtagttcccctaacctcaatatgggagttggtggccca
ggtcaagtcatggccagccaggcccaacaaaacagtcctggattaggtttgataaatagc
atggtgaaaagcccaatgacacaggcaggcttgacttctcccaacatggggatgggcact
agtggaccaaatcagggtcccacgcagtcaacaggtatgatgaacagtccagtaaatcag
cctgccatgggaatgaacacagggatgaatgctggcatgaatcctggaatgttggctgca
ggcaatggacaagggataatgcctaatcaagtcatgaacggttcaattggagcaggccga
gggcgacagaatatgcagtacccaaacccaggcatgggaagtgctggcaacttactgact
gagcctcttcagcagggctctccccagatgggaggacaaacaggattgagaggcccccag
cctcttaagatgggaatgatgaacaaccccaatccttacggttcaccatacactcagaat
cctggacagcagattggagccagtggccttggtctccagattcagacaaagactgtacta
tcaaataacttatctccatttgctatggacaaaaagacagttcctggtggaggaatgccc
aacatgggtcaacaaccagccccgcaggtccagcagccaggcctggtgactccagttgcc
caagggatgggttctggagcacatacagctgatccagagaagcgcaagctcatccagcag
caacttgttctccttttgcatgctcacaagtgccagcgccgggagcaggccaatggggaa
gtgaggcagtgcaaccttccccactgtcgcacaatgaagaatgtcctaaaccacatgaca
cactgccagtcaggcaagtcttgccaagtggcacactgtgcatcttctcgacaaatcatt
tcacactggaagaattgtacaagacatgactgtcctgtgtgtctgcccctcaaaaatgct
ggtgataagagaaatcaacagccaattttgactggagcacctgttggacttggaaatcct
agctctctaggggtgggtcaacagtctacccccaacctaagcactgttagtcagattgat
cccagctctatagaaagagcctatgcagctctcggactaccctatcaagtaaatcagatg
ccgacacaaccccaggtgcaagcaaagaaccagcagaatcagcagcctgggcagtctccc
caaggcatgcgacccatgagcaacatgagtgctagtcctatgggagtaaatggaggtgta
ggagttcaaacgccgagtcttctttctgactcaatgttgcattcagccataaattctcaa
aacccaatgatgagtgaaaatgcgagtgtgccctccctgggtcctatgccaacagcagct
caaccatccagtactggaattcggaaacagtggcatgaagatattactcaggatcttcga
aatcatcttgttcacaaactcgtccaagccatatttcctacaccggatcctgctgcttta
aaagacagacggatggaaaacctagttgcatatgctcggaaagtcgaaggagacatgtat
gaatctgcaaacaatcgagcggagtactaccaccttctagctgagaaaatctataagatc
cagaaggaactagaagaaaaacgaaggactagactacagaaacagaacatgctaccaaat
gctgcaggcatggttccagtttccatgaatccagggcctaacatgggacagccgcaacca
ggaatgacttctaatggtcctctgcctgacccaactatgatccgtggcagtgtgccaaac
cagatgatgcctcggataactccacaatctggtttgaatcaatttggccagatgagcatg
gcccagccccctatcgtaccccggcaaaccgctcctcttcaacaccatggacagttggct
cagcctggagcgctcaacctgcctatgggctatgggcctcgtatgcaacagccttccaac
cagagccagttccttcctcagactcagttcccatcacagggaatgaatgtaacaaatatg
cctttggctccgtccagtggtcaagctccagtgtctcaagcacaaatgtctagttcttcc
tgcccggtgaactctcctataatgcctccggggtctcaggggagccacattcactgtccc
cagcttcctcaaccagctttgcatcagaattcaccctcgcctgtacctagtcgtaccccg
acccctcaccatactcccccaagcataggggctcagcagccaccagcaacaacaattcca
gcccctgttcctacacctcctgccatgccacctggaccacagtcccaggctctacatccc
cctccaaggcagacacctacaccaccaacaacacaacttccccaacaagtacagccttca
cttcctgctgcaccttctgctgaccagccccagcagcagcctcgctcacagcagagcaca
gcagcgtctgttcctaccccaacagcaccgctgcttgctccacagcctgcaactccactt
tcccagccagctgtaagcattgaaggacaggtgtcaaaccctccatctactagtagcaca
gaagtgaattctcaggccattcctgagaagcagccttcccaggaagtgaagatggaggcc
aaaatggaagtggatcaaccagaaccagcagatactcaaccggaggatatttcagagtct
aaagtggaagactgtaaaatggaacctacagaaacagaagagagaagcactgagttaaaa
actgaaataaaagaggaggaagatcagccaagtacttcagctacccagtcatctccagct
ccaggacagtcaaagaaaaagattttcaaaccagaagaactacgacaggcactgatgcca
acattggaggcactttaccgtcaggatccagaatcccttccttttcgtcaacctgtggac
cctcagcttttaggaattcctgattactttgatattgtgaagagccccatggatctttct
accattaagaggaagttagacactggacagtatcaggagccctggcaatatgtcgatgat
atttggcttatgttcaataatgcctggttatataaccggaaaacatcacgggtatacaaa
tactgctccaagctctctgaggtctttgaacaagaaattgacccagtgatgcaaagcctt
ggatactgttgtggcagaaagttggagttctctccacagacactgtgttgctacggcaaa
cagttgtgcacaatacctcgtgatgccacttattacagttaccagaacaggtatcatttc
tgtgagaagtgtttcaatgagatccaaggggagagcgtttctttgggggatgacccttcc
cagcctcaaactacaataaataaagaacaattttccaaaagaaaaaatgacacactggat
cctgaactgtttgttgaatgtacagagtgcggaagaaagatgcatcagatctgtgtcctt
caccatgagatcatctggcccgctggattcgtctgtgatggctgtttaaagaaaagtgca
cgaactaggaaagaaaataagttttctgctaaaaggttgccatctaccagacttggcacc
tttctagagaatcgtgtgaatgactttctgaggcgacagaatcaccctgagtcaggagag
gtcactgttagagtagttcatgcttctgacaaaaccgtggaagtaaaaccaggcatgaaa
gcaaggtttgtggacagtggagagatggcagaatcctttccataccgaaccaaagccctc
tttgcctttgaagaaattgatggcgttgacctgtgcttctttggcatgcatgttcaagag
tatggctctgactgccctccacccaaccagaggagagtatacatatcttacctcgatagt
gttcatttcttccgtcctaaatgcttgaggactgcagtctatcatgaaatcctgattgga
tatttagaatatgtcaagaaattaggttacacaacagggcatatttgggcatgtccacca
agtgagggagatgattatatcttccattgccatcctcctgaccagaagatacccaagccc
aagcgactgcaggaatggtacaaaaaaatgcttgacaaggctgtatcagagcgtattgtc
catgactacaaggatatttttaaacaagctactgaagatagattaacaagtgcaaaggaa
ttgccttacttcgagggtgatttctggcccaatgttctggaagaaagcattaaggaactg
gaacaggaggaagaagagagaaaacgagaagaaaacaccagcaatgaaagcacagatgtg
accaagggagacagtaaaaatgctaaaaagaagaataataagaaaaccagcaaaaataag
agcagcctaagtaggggcaacaagaagaaacctgggatgcccaatgtatctaacgacctc
tcacagaaactatatgccaccatggagaagcataaagaggtcttctttgtgatccgcctc
attgctggccctactgccaactccctgcctcccattgttgatcctgaccctctcatcccc
tgtgatctgatggatggtcgggatgcgtttctcacgctggcaagagacaagcacctggag
ttctcttcactccgaagagcccagtggtccaccatgtgcatgctggtggagctgcacacg
cagagccaggaccgctttgtctacacctgcaatgaatgcaagcaccatgtggagacacgc
tggcactgtactgtctgtgaggattatgacttgtgtatcacctgctataacactaaaaac
catgaccacaaaatggagaaactaggtcttggcttagatgatgagagcaacaaccagcag
gctgcagccacccagagcccaggcgattctcgccgcctgagtatccagcgctgcatccag
tctctggtccatgcttgccagtgtcggaatgccaattgctccctgccatcctgccagaag
atgaagcgggttgtgcagcataccaagggttgcaaacggaaaaccaatggcgggtgcccc
atctgcaagcagctcatcgccctctgctgctaccatgccaagcactgccaggagaacaaa
tgcccagtgccgttctgcctaaacatcaagcagaagctccggcagcagcagctgcagcac
cgactacaacaggcccaaatgcttcgcagaaggatggccagcatgcagcggactggtgtg
gtcgggcagcaacagggcctcccttcccccactcctgccactccaacgacaccaactggc
caacagccaaccaccccacagacgccccagcccacctctcagcctcagcctacccctccc
aatagtatgccaccctacttgcccaggactcaagctgctggccctgtgtcccagggtaag
gcagcaggccaggtgacccctccaacccctcctcagactgctcagccaccccttccaggg
cccccacctgcagcagtggaaatggcaatgcagattcagagagcagcagagacgcagcgc
cagatggcccacgtgcaaatttttcaaaggccaatccaacatcagatgcccccgatgact
cccatggcccccatgggtatgaacccacctcccatgaccagaggtcccagtgggcatttg
gagccagggatgggaccgacggggatgcagcaacagccaccctggggccaaggaggattg
cctcagccccagcaactacagtctgggatgccaaggccagccatgatgtcagtggcccag
catggtcaacccttgaacatggctccacaaccaggattgggccaggtaggtgtgagccca
ctcaaaccaggcactgtgtctcaacaagccttacaaaaccttttgcggactctcaggtct
cccagctctcccctacagcagcaacaggtgcttagtatccttcacgccaacccccagctg
ttggctgcattcatcaagcagcgggctgccaagtatgccaactctaatccacaacccatc
cctgggcagcctggcatgccccaggggcagccagggctgcagccacctaccatgccaggt
cagcagggggtccactccaatccagccatgcagaacatgaatccaatgcaggcgggcgtc
cagagggctggcctgccccagcagcaaccccagcagcaactccagccgcccatgggaggg
atgagcccccagtctcagcagatgaacatgaaccacaacaccatgccttcacaattccga
gacatcttgagacgacaacagatgatgcaacagcagcagcaacagggagcagggccagga
ataggcccaggaatggctaaccataaccagttccagcaaccccaaggagttggctaccca
ccacagcagcagcagcggatgcaacatcacatgcaacagatgcaacaaggaaatatggga
cagatgggccagctcccccaggccttgggagcagaggcaggtgccagtctacaggcctat
cagcagcgactccttcagcaacagatggggtctcctgctcagcccaaccccatgagcccc
cagcagcatatgctcccaaatcaggcccagtctccacacctacaaggccagcagatccct
aattctctctccaatcaagtgcgctctccgcagcctgtcccttctccacggccacagtcc
cagcccccccactccagcccttctccaaggatgcagcctcagccttctccacaccacgtt
tccccacagacaagttccccgcatcctggactggtagctgcccaggccaaccccatggaa
caagggcattttgccagcccggaccagaattcaatgctttctcagcttgctagcaatcca
ggcatggcaaacctccatggtgcaagcgccacagacctgggactcagcaccgataactca
gacttgaattcaaacctctcacagagtacactagacatacactag

DBGET integrated database retrieval system