KEGG   Macaca mulatta (rhesus monkey): 704387
Entry
704387            CDS       T01028                                 

Gene name
CDH1
Definition
(RefSeq) cadherin-1
  KO
K05689  cadherin 1, type 1, E-cadherin
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04015  Rap1 signaling pathway
mcc04371  Apelin signaling pathway
mcc04390  Hippo signaling pathway
mcc04514  Cell adhesion molecules
mcc04520  Adherens junction
mcc05100  Bacterial invasion of epithelial cells
mcc05200  Pathways in cancer
mcc05213  Endometrial cancer
mcc05216  Thyroid cancer
mcc05218  Melanoma
mcc05219  Bladder cancer
mcc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    704387 (CDH1)
   04390 Hippo signaling pathway
    704387 (CDH1)
   04371 Apelin signaling pathway
    704387 (CDH1)
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    704387 (CDH1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    704387 (CDH1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    704387 (CDH1)
  09162 Cancer: specific types
   05226 Gastric cancer
    704387 (CDH1)
   05216 Thyroid cancer
    704387 (CDH1)
   05218 Melanoma
    704387 (CDH1)
   05219 Bladder cancer
    704387 (CDH1)
   05213 Endometrial cancer
    704387 (CDH1)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    704387 (CDH1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mcc03036]
    704387 (CDH1)
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:mcc04515]
    704387 (CDH1)
   04090 CD molecules [BR:mcc04090]
    704387 (CDH1)
Chromosome and associated proteins [BR:mcc03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    704387 (CDH1)
Cell adhesion molecules [BR:mcc04515]
 Cadherins
  Major cadherins
   704387 (CDH1)
CD molecules [BR:mcc04090]
 Proteins
  704387 (CDH1)
SSDB
Motif
Pfam: Cadherin Cadherin_C Cadherin_pro Cadherin_2 RET_CLD1 Cadherin_3 Phage_holin_5_2 Big_9
Other DBs
NCBI-GeneID: 704387
NCBI-ProteinID: XP_014981971
Ensembl: ENSMMUG00000011850
LinkDB
Position
20
AA seq 882 aa
MGPWSRSLSALLLLLQVSSWLCQEPEPCHPGFDAESYTFTVPRRHLERGRVLGRVSFEDC
TGRQRTAYFSLDTRFKVGPDGVITVKRPLQFHNPQIHFLVYAWDSTYRKFSTKVTLNTVG
HHSRTPPLHASVSGVQAELLTFPNSSPGLRRWKRDWVIPPISCPENEKGPFPKNLVQIKS
NKDKEGKVFYSITGQGADTPPVGVFIIERETGWLKVTEPLDRENIATYTLFSHAVSSNGN
AVEDPMEILITVTDQNDNKPVFTQEVFKGSVMEGALPGTSVMEVTATDADDDVNTYNAAI
AYSILSQDPELPDKNMFTINKNTGVISVVTTGLDRESFPMYTLVVQAADLQGEGLSTTAT
AVITVTDTNDNPPVFNPTTYKGQVPENQANFVITTLKVTDADAPNTPAWEAVYTILNDND
GQFVVTTNPVTNDGILKTAKGLDFEAKQQYILHVAVTNVAPFEVSLTTSTATVTVDVLDV
NEAPIFVPPEKRVEVSEDFGVGQEITSYTAREPDTFMEQKITYRIWRDAANWLEINPDTG
AISTRAELDREDIEHVKNSTYTALIIATDNGSPVATGTGTLLLILSDVNDNAPIPESRNL
FFCERNPKPQVINIIDADLPPNTSPFTAELMHGASANWTIEYNDPTQESIILKPKIALEV
GDYKINLKLMDNQKKDQVTTLEVSVCDCEGAAGICKKAPLVEAGMQIPAILGILGGILAL
LILILLLLLFLRRRAVVKEPLLPPEDDTRDNVYYYDEEGGGEEDQDFDLSQLHRGLDARP
EVTRNDVAPTLLSVPRYLPRPANPDEIGNFIDENLKAADSDPTAPPYDSLLVFDYEGSGS
EAASLSSLNSSESDKDQDYDYLNEWGNRFKKLADMYGGGEDD
NT seq 2649 nt   +upstreamnt  +downstreamnt
atgggcccttggagccgcagcctgtcggcgctgctgctgctgctgcaggtctcgtcttgg
ctctgccaggagccggagccctgccaccccggctttgacgccgagagctacacgttcacg
gtgccccggcggcacctggagagaggacgcgtcctgggcagagtgagttttgaagattgc
accggtcgacaaaggacagcctatttttccctcgacacccgattcaaagtgggcccagat
ggtgtgattacagtcaaaaggcctctacagtttcataacccacagatccatttcttggtc
tacgcctgggactccacctacagaaagttttccaccaaagtcacgctgaatacagtgggg
caccacagccgcaccccgccccttcatgcctctgtttctggagtccaagcagaattgctc
acatttcccaactcctctcctggcctcagaagatggaagagagactgggttattcctcct
atcagctgcccagaaaatgaaaaaggcccatttcctaaaaacctggttcagatcaaatcc
aacaaagacaaagaaggcaaggttttctacagcatcactggccaaggagctgacacacca
cctgttggcgtctttattattgaaagagaaacaggatggctgaaagtgacagagcctctg
gatagagaaaacattgccacatacactctcttctctcatgctgtgtcatccaacgggaat
gcagttgaggacccaatggagattttgatcacggtgaccgatcagaatgacaacaagccc
gtgttcacccaggaggtctttaaggggtctgtcatggaaggtgctcttccagggacctcc
gtaatggaggtcacagccacagacgcggacgatgatgtgaacacctacaatgccgccatc
gcttacagcatcctcagccaagatcctgagctgcctgacaaaaatatgttcaccattaac
aagaacacaggagtcatcagtgtggtcaccactgggctggaccgagagagtttccctatg
tataccctggtggttcaagctgctgaccttcaaggtgaagggttaagcacaacagcaaca
gctgtgatcacagtcactgacaccaatgataaccctccagtcttcaatcccaccacgtac
aagggtcaggtgcctgagaaccaggcgaacttcgtaatcaccacactgaaagtgactgat
gctgatgcccccaataccccagcgtgggaggctgtatacactatattgaatgataatgac
ggacaatttgttgtcaccacaaatccagtgaccaacgatggcattttgaaaacagcaaag
ggcttggattttgaggccaagcagcagtacattctacacgtggcagtgacgaacgtggcg
ccttttgaggtctctctcaccacctccacagccactgtcaccgtggatgtgctggatgtg
aacgaagcccccatctttgtgcctccagaaaagagagtggaagtgtccgaggactttggc
gtgggccaggaaatcacatcctacactgcccgggagccagacacatttatggaacagaaa
ataacgtatcggatttggagagacgctgccaactggctggagattaatccggacactggt
gccatttccactcgggctgagctggacagggaggacattgagcacgtgaagaacagcacg
tacacagccctcatcatagctacagacaatggttctccagttgctactggaacagggact
cttctgctgatcctgtctgatgtgaatgacaacgcccctataccagaatctcgaaatcta
ttcttctgcgagaggaatccaaagcctcaggtcataaacatcattgatgcagaccttcct
cccaatacatctcccttcacagcagaactaatgcatggggcgagtgccaactggaccatt
gagtacaacgacccaacccaagaatctatcattttgaagccaaagatagccttagaggtg
ggtgactacaaaatcaatctcaaactcatggataaccagaagaaagaccaagtgaccacc
ttagaggtcagcgtgtgtgactgtgaaggggccgccggcatctgtaagaaggcaccgctt
gtcgaagcaggaatgcaaattcctgccattctggggattcttggaggaattcttgctttg
ctaattctgattctgctgctcttgctgtttcttcggaggagagcggtggtcaaagagccc
ttactgcccccagaggatgacacccgggacaatgtttattactatgatgaagaaggaggt
ggagaagaggaccaggactttgacttgagccagttgcacaggggcctggatgctcggcct
gaagtgactcgtaacgacgttgcaccaaccctcctgagtgtcccccggtaccttccccgc
cctgccaatcctgatgaaattggaaattttattgatgaaaatctgaaggcagctgatagt
gaccccacggccccaccttatgattctctgctcgtgtttgactatgaaggaagcggttcc
gaagctgctagtctgagctccctgaactcttcagagtcagacaaagaccaggactatgat
tacttgaatgaatggggcaatcgcttcaagaagctggcagacatgtacggaggcggcgag
gatgactag

DBGET integrated database retrieval system