KEGG   Macaca mulatta (rhesus monkey): 704534
Entry
704534            CDS       T01028                                 

Gene name
INS
Definition
(RefSeq) insulin
  KO
K04526  insulin
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04010  MAPK signaling pathway
mcc04014  Ras signaling pathway
mcc04015  Rap1 signaling pathway
mcc04022  cGMP-PKG signaling pathway
mcc04066  HIF-1 signaling pathway
mcc04068  FoxO signaling pathway
mcc04072  Phospholipase D signaling pathway
mcc04114  Oocyte meiosis
mcc04140  Autophagy - animal
mcc04150  mTOR signaling pathway
mcc04151  PI3K-Akt signaling pathway
mcc04152  AMPK signaling pathway
mcc04211  Longevity regulating pathway
mcc04213  Longevity regulating pathway - multiple species
mcc04810  Regulation of actin cytoskeleton
mcc04910  Insulin signaling pathway
mcc04911  Insulin secretion
mcc04913  Ovarian steroidogenesis
mcc04914  Progesterone-mediated oocyte maturation
mcc04917  Prolactin signaling pathway
mcc04923  Regulation of lipolysis in adipocytes
mcc04930  Type II diabetes mellitus
mcc04931  Insulin resistance
mcc04932  Non-alcoholic fatty liver disease
mcc04940  Type I diabetes mellitus
mcc04950  Maturity onset diabetes of the young
mcc04960  Aldosterone-regulated sodium reabsorption
mcc05010  Alzheimer disease
mcc05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    704534 (INS)
   04014 Ras signaling pathway
    704534 (INS)
   04015 Rap1 signaling pathway
    704534 (INS)
   04066 HIF-1 signaling pathway
    704534 (INS)
   04068 FoxO signaling pathway
    704534 (INS)
   04072 Phospholipase D signaling pathway
    704534 (INS)
   04022 cGMP-PKG signaling pathway
    704534 (INS)
   04151 PI3K-Akt signaling pathway
    704534 (INS)
   04152 AMPK signaling pathway
    704534 (INS)
   04150 mTOR signaling pathway
    704534 (INS)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    704534 (INS)
  09143 Cell growth and death
   04114 Oocyte meiosis
    704534 (INS)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    704534 (INS)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    704534 (INS)
   04910 Insulin signaling pathway
    704534 (INS)
   04923 Regulation of lipolysis in adipocytes
    704534 (INS)
   04913 Ovarian steroidogenesis
    704534 (INS)
   04914 Progesterone-mediated oocyte maturation
    704534 (INS)
   04917 Prolactin signaling pathway
    704534 (INS)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    704534 (INS)
  09149 Aging
   04211 Longevity regulating pathway
    704534 (INS)
   04213 Longevity regulating pathway - multiple species
    704534 (INS)
 09160 Human Diseases
  09162 Cancer: specific types
   05215 Prostate cancer
    704534 (INS)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    704534 (INS)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    704534 (INS)
   04940 Type I diabetes mellitus
    704534 (INS)
   04950 Maturity onset diabetes of the young
    704534 (INS)
   04932 Non-alcoholic fatty liver disease
    704534 (INS)
   04931 Insulin resistance
    704534 (INS)
SSDB
Motif
Pfam: Insulin Ins_beta
Other DBs
NCBI-GeneID: 704534
NCBI-ProteinID: XP_028688882
LinkDB
Position
14
AA seq 110 aa
MALWMRLLPLLALLALWGPDPAPAFVNQHLCGSHLVEALYLVCGERGFFYTPKTRREAED
PQVGQVELGGGPGAGSLQPLALEGSLQKRGIVEQCCTSICSLYQLENYCN
NT seq 333 nt   +upstreamnt  +downstreamnt
atggccctgtggatgcgcctcttgcccctgctggcgctgctggccctctggggacctgac
ccggccccggcctttgtgaaccagcacctgtgcggctcccacctggtggaagctctctac
ctggtgtgcggggagcgaggcttcttctacacacccaagacccgccgggaggcagaggac
cctcaggtggggcaggtggagctgggcgggggccctggcgcaggcagcctgcagcccttg
gcgctggaggggtccctgcagaagcgcggcatcgtggagcagtgctgcaccagcatctgc
tccctctaccagctggagaactactgcaactag

DBGET integrated database retrieval system