KEGG   Macaca mulatta (rhesus monkey): 704562
Entry
704562            CDS       T01028                                 

Gene name
MET
Definition
(RefSeq) hepatocyte growth factor receptor precursor
  KO
K05099  proto-oncogene tyrosine-protein kinase Met [EC:2.7.10.1]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc01521  EGFR tyrosine kinase inhibitor resistance
mcc04010  MAPK signaling pathway
mcc04014  Ras signaling pathway
mcc04015  Rap1 signaling pathway
mcc04020  Calcium signaling pathway
mcc04151  PI3K-Akt signaling pathway
mcc04360  Axon guidance
mcc04510  Focal adhesion
mcc04520  Adherens junction
mcc05100  Bacterial invasion of epithelial cells
mcc05144  Malaria
mcc05200  Pathways in cancer
mcc05202  Transcriptional misregulation in cancer
mcc05205  Proteoglycans in cancer
mcc05206  MicroRNAs in cancer
mcc05211  Renal cell carcinoma
mcc05218  Melanoma
mcc05223  Non-small cell lung cancer
mcc05225  Hepatocellular carcinoma
mcc05226  Gastric cancer
mcc05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    704562 (MET)
   04014 Ras signaling pathway
    704562 (MET)
   04015 Rap1 signaling pathway
    704562 (MET)
   04020 Calcium signaling pathway
    704562 (MET)
   04151 PI3K-Akt signaling pathway
    704562 (MET)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    704562 (MET)
   04520 Adherens junction
    704562 (MET)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    704562 (MET)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    704562 (MET)
   05202 Transcriptional misregulation in cancer
    704562 (MET)
   05206 MicroRNAs in cancer
    704562 (MET)
   05205 Proteoglycans in cancer
    704562 (MET)
   05230 Central carbon metabolism in cancer
    704562 (MET)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    704562 (MET)
   05226 Gastric cancer
    704562 (MET)
   05218 Melanoma
    704562 (MET)
   05211 Renal cell carcinoma
    704562 (MET)
   05223 Non-small cell lung cancer
    704562 (MET)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    704562 (MET)
  09174 Infectious disease: parasitic
   05144 Malaria
    704562 (MET)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    704562 (MET)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcc01001]
    704562 (MET)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     704562 (MET)
Protein kinases [BR:mcc01001]
 Receptor tyrosine kinases (RTK)
  MET family
   704562 (MET)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Sema TIG Pkinase PSI Pkinase_fungal Kinase-like
Other DBs
NCBI-GeneID: 704562
NCBI-ProteinID: NP_001162100
Ensembl: ENSMMUG00000006779
UniProt: G7MM61
LinkDB
Position
3
AA seq 1381 aa
MKAPAVLVPGILVLLFTLVQRSNGECKEALAKSEMNVNMKYQLPNFTAETAIQNVILHEH
HIFLGATNYIYVLNEEDLQKVAEYKTGPVLEHPDCFPCQDCSSKANLSGGVWKDNINMAL
VVDTYYDDQLISCGSVNRGTCQRHVFPHNHTADIQSEVHCIFSPQIEEPNQCPDCVVSAL
GAKVLSSVKDRFINFFVGNTINSSYFPHHPLHSISVRRLKETKDGFMFLTDQSYIDVLPE
FRDSYPIKYIHAFESNNFIYFLTVQRETLNAQTFHTRIIRFCSLNSGLHSYMEMPLECIL
TEKRKKRSTKKEVFNILQAAYVSKPGAQLARQIGASLNDDILFGVFAQSKPDSAEPMDRS
AMCAFPIKYVNDFFNKIVNKNNVRCLQHFYGPNHEHCFNRTLLRNSSGCEARRDEYRAEF
TTALQRVDLFMGQFSEVLLTSISTFVKGDLTIANLGTSEGRFMQVVVSRSGPSTPHVNFL
LDSHPVSPEVIVEHPLNQNGYTLVVTGKKITKIPLNGLGCRHFQSCSQCLSAPPFVQCGW
CHDKCVRSEECPSGTWTQQICLPAIYKVFPTSAPLEGGTRLTICGWDFGFRRNNKFDLKK
TRVLLGNESCTLTLSESTMNTLKCTVGPAMNKHFNMSIIISNGHGTTQYSTFSYVDPIIT
SISPKYGPMAGGTLLTLTGNYLNSGNSRHISIGGKTCTLKSVSNSILECYTPAQTISTEF
AVKLKIDLANRETSIFSYREDPIVYEIHPTKSFISGGSTITGVGKNLHSVSVPRMVINVH
EAGRNFTVACQHRSNSEIICCTTPSLQQLNLQLPLKTKAFFMLDGILSKYFDLIYVHNPV
FKPFEKPVMISMGNENVLEIKGNDIDPEAVKGEVLKVGNKSCENIHLHSEAVLCTVPNDL
LKLNSELNIEWKQAISSTVLGKVIVQPDQNFTGLIAGVVSISIALLLLLGLFLWLKKRKQ
IKDLGSELVRYDARVHTPHLDRLVSARSVSPTTEMVSNESVDYRATFPEDQFPNSSQNGS
CRQVQYPLTDMSPILTSGDSDISSPLLQNTVHIDLSALNPELVQAVQHVVIGPSSLIVHF
NEVIGRGHFGCVYHGTLLDNDGKKIHCAVKSLNRITDIGEVSQFLTEGIIMKDFSHPNVL
SLLGICLRSEGSPLVVLPYMKHGDLRNFIRNETHNPTVKDLIGFGLQVAKGMKYLASKKF
VHRDLAARNCMLDEKFTVKVADFGLARDMYDKEYYSVHNKTGAKLPVKWMALESLQTQKF
TTKSDVWSFGVLLWELMTRGAPPYPDVNTFDITVYLLQGRRLLQPEYCPDPLYEVMLKCW
HPKAEMRPSFSELVSRISAIFSTFIGEHYVHVNATYVNVKCVAPYPSLLSSEDNADDEVD
T
NT seq 4146 nt   +upstreamnt  +downstreamnt
atgaaggcccccgctgtgcttgtacctggcatcctcgtgctcctgtttaccttggtgcag
aggagcaatggggagtgtaaagaggcactagcaaagtccgagatgaatgtgaatatgaag
tatcagcttcccaacttcaccgcggaaacagccatccagaatgtcattctacatgagcat
cacattttcctcggtgccaccaactacatttatgttttaaatgaggaagaccttcagaag
gttgctgagtacaagaccgggcctgtgctggaacacccagattgtttcccgtgtcaggac
tgcagcagcaaagccaatttatcaggaggcgtttggaaagataacatcaacatggctctg
gttgtcgacacctactatgatgatcaactcattagctgtggcagcgtcaacagagggacc
tgccagcgacatgtctttccccataatcatactgctgacatacagtcggaggttcactgc
atattctccccacagatagaagagcccaaccagtgccctgactgtgtggtgagcgccctg
ggagccaaagtcctttcatctgtaaaggaccggttcatcaacttctttgtaggcaatacc
ataaattcttcttatttcccacatcatccgttgcattcgatatcagtgagaaggctaaag
gaaacgaaagatggttttatgtttttgacggaccagtcctacattgatgttttacctgag
ttcagagattcttaccccattaagtacatccatgcttttgaaagcaacaattttatttac
ttcttgacggtccaaagggaaactctaaatgctcagacttttcacacaagaataatcagg
ttctgttccttaaactctggattgcactcctacatggaaatgcctctagagtgtattctc
acagaaaagagaaaaaagagatccacaaagaaggaagtgtttaatatccttcaggctgca
tatgtcagcaagcccggggcccagcttgctagacaaataggagccagcctgaatgatgac
attctctttggggtgttcgcacaaagcaagccagattctgccgaaccaatggatcgatct
gcaatgtgtgcattccctatcaaatatgtcaacgacttcttcaacaagatcgtcaacaaa
aacaatgtgagatgtctccagcatttttatggacccaatcatgagcactgttttaatagg
acacttctgagaaattcatcaggctgtgaagcgcgccgtgatgaatatcgagcagagttt
accacagctttgcagcgcgttgacttattcatgggtcaattcagcgaagtcctcttaaca
tctatatccaccttcgtgaaaggagacctcaccatcgctaatcttgggacatcagagggt
cgcttcatgcaggttgtggtttctcgatcaggaccatcaacccctcatgtgaattttctc
ctggactctcacccggtgtctccagaagtgattgtggagcatccattaaaccagaatggc
tacacactggttgtcacggggaagaagatcaccaagatcccattgaatggcttgggctgc
agacatttccagtcctgcagtcagtgcctctctgccccaccctttgtgcagtgtggctgg
tgccacgacaaatgtgtgcgatcggaggagtgccccagtgggacatggactcaacagatc
tgtctgcctgcaatctacaaggttttcccaactagtgcaccccttgaaggagggacaaga
ctgaccatatgtggctgggactttggatttcggaggaataataaatttgatttaaagaaa
actagagttctccttggaaatgagagctgcaccttgactttaagtgagagcacgatgaat
acattgaaatgcacagttggtcctgccatgaataaacatttcaatatgtccataattatt
tcaaatggccatgggacaacacaatacagtacattttcctatgtggatcctataataaca
agtatttcgccaaaatatggccctatggctggtggcactttacttactttaactggaaat
tacctaaacagtgggaattctagacacatttcaattggtggaaaaacatgtactttaaaa
agtgtgtcaaacagtattctcgaatgttataccccagcccaaaccatttcaactgagttt
gctgttaaattgaaaattgacttagccaaccgagagacaagcatcttcagttaccgggaa
gaccccattgtctatgaaattcatccaaccaaatcttttattagtggtgggagcacaata
acaggtgttgggaaaaacctgcattcagttagtgtcccgaggatggtcataaatgtgcat
gaagcaggaaggaactttacagtggcatgtcagcatcgctctaattcagagataatctgc
tgtaccactccttccctgcaacagctgaatctgcaactccctctgaaaaccaaagccttt
ttcatgttagatgggatcctttccaaatactttgatctcatttatgtacataatcctgtg
tttaagccttttgaaaagccagtaatgatctcaatgggcaatgaaaatgtactggaaatt
aagggaaatgatattgaccctgaagcagttaaaggtgaagtgttaaaagttggaaataag
agctgtgagaatatacacttacattctgaagccgttttatgcacggtccccaatgacctg
ctgaaattgaacagcgagctaaatatagagtggaagcaagcaatttcttcaaccgtcctt
ggaaaagtaatagttcaaccagatcagaatttcaccggattgattgctggtgttgtctca
atatcaatagcactcttactactacttgggcttttcctgtggctgaaaaagagaaagcaa
attaaagatctgggcagtgaattagttcgctatgatgcaagagtacacactcctcatttg
gataggcttgtaagtgcccgaagtgtaagcccaacaacagaaatggtttcaaatgaatct
gtagactaccgagctacttttccagaagatcagtttcctaattcatctcagaacggttca
tgccgacaagtgcagtatcctctgacagacatgtcccccatcctgactagtggggactct
gatatatccagtccattactgcaaaacactgtccacattgacctcagcgctctaaatcca
gagctggtccaggcagtgcagcatgtagtgattgggcccagtagcctgattgtgcatttc
aatgaagtcataggaagagggcattttggttgtgtatatcatgggactttgttggacaat
gatggcaagaaaattcactgtgctgtgaaatccttgaacagaatcactgacataggagaa
gtttcccagtttctgaccgagggaatcatcatgaaagattttagtcatcccaatgtcctc
tcgctcctgggaatctgcctgcgaagtgaagggtctccgctggtggtcctaccctacatg
aaacatggagatcttcgaaatttcattcgaaatgagactcataatccaactgtaaaagat
cttattggctttggtcttcaagtagccaaaggcatgaaatatcttgcaagcaaaaagttt
gtccacagagacttggctgcaagaaactgtatgctggatgaaaaattcacagtcaaggtt
gctgattttggtcttgccagagacatgtatgataaagaatactatagtgtgcacaacaaa
acaggtgcaaagctgccagtgaagtggatggctttggaaagtctgcaaactcaaaagttt
accaccaagtcagatgtgtggtcctttggtgtgctcctctgggagctcatgacaagagga
gccccaccctatcctgacgtgaacacctttgatataactgtttacttgttgcaagggaga
aggctcctacaacccgaatactgcccagaccccttatatgaagtaatgctaaaatgctgg
caccctaaagcagaaatgcgcccatccttttctgaactggtgtcccggatatcagcgatc
ttctctactttcattggggagcactacgtccatgtaaacgctacttatgtgaacgtaaaa
tgtgtcgctccatatccttctctgttgtcatcagaagataacgctgatgacgaggtggac
acatga

DBGET integrated database retrieval system