KEGG   Macaca mulatta (rhesus monkey): 704638
Entry
704638            CDS       T01028                                 

Gene name
DDX58
Definition
(RefSeq) probable ATP-dependent RNA helicase DDX58
  KO
K12646  ATP-dependent RNA helicase DDX58 [EC:3.6.4.13]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04064  NF-kappa B signaling pathway
mcc04622  RIG-I-like receptor signaling pathway
mcc04623  Cytosolic DNA-sensing pathway
mcc05160  Hepatitis C
mcc05161  Hepatitis B
mcc05162  Measles
mcc05164  Influenza A
mcc05168  Herpes simplex virus 1 infection
mcc05169  Epstein-Barr virus infection
mcc05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    704638 (DDX58)
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    704638 (DDX58)
   04623 Cytosolic DNA-sensing pathway
    704638 (DDX58)
 09160 Human Diseases
  09172 Infectious disease: viral
   05161 Hepatitis B
    704638 (DDX58)
   05160 Hepatitis C
    704638 (DDX58)
   05171 Coronavirus disease - COVID-19
    704638 (DDX58)
   05164 Influenza A
    704638 (DDX58)
   05162 Measles
    704638 (DDX58)
   05168 Herpes simplex virus 1 infection
    704638 (DDX58)
   05169 Epstein-Barr virus infection
    704638 (DDX58)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:mcc04054]
    704638 (DDX58)
Enzymes [BR:mcc01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     704638 (DDX58)
Pattern recognition receptors [BR:mcc04054]
 Cytoplasmic pattern recognition receptors
  RIG-I-like receptors
   704638 (DDX58)
SSDB
Motif
Pfam: CARD_2 RIG-I_C RIG-I_C-RD DEAD ResIII Helicase_C AAA_22 AAA_25
Other DBs
NCBI-GeneID: 704638
NCBI-ProteinID: NP_001036133
Ensembl: ENSMMUG00000012442
UniProt: Q0PXR1
LinkDB
Position
15
AA seq 925 aa
MTTEQRRSLLAFQDYIRKTLDPTYILSYMAPWFREEEVQYIQAEKNNKGPMEAATLFLKF
LLELQEEGWFRGFLDALDHAGYSGLYEAIESWDFKKIEKLEEYRLLLKRLQPEFKTRIIP
TDILSDLSECLINQECEEILQICSTKGMMAGAEKLVECLLRSDKENWPKTLKLALERERN
KFSELWTVEKGIKDVETEDLEDKMETSDIQIFYQEDPECQNLSENSCLPSEVSDTNLYSP
FKLRNYQLELALPAKKGKNTIICAPTGCGKTLVAVLICEHHLKKFPPGQKGKVVFFANQI
PVYEQQESVFSKYFERLGYRVTGISGATAENVPVEQIVENNDIIILTPQILVNNLKKGTI
PSLSVFTLMIFDECHNTSKQHPYNMIMFNYLDQKLGGSSGPLPQVIGLTASVGVGDAKDT
DEALDYICKLCASLDASVIATVKDNLEELEQVVYKPQKFFRKVESRVSDKFKCIIAQLMR
DTESLAKRICKDLESFSQIQNREFGTQKYEQWIVTVQKACMVFQMPDKDEESRICKALFL
YTSHLRKYNDALIISEHARLKDALDYLKDFFSNVRAAGFDETEQDLTQRFEEKLQELESV
SRDPSNENPKLEDLCFILQEEYHLNPETITILFVKTRALVDALKNWIEGNPKLHFLKPGI
LTGRGKTNQNTGMTLPAQKCILEAFKVNGDHNILIATSVADEGIDIAQCNLVILYEYVGN
VIKMIQTRGRGRARGSKCFLLTSNAGVIEKEQINMYKEKMMNDCILHLQTWDEAVFREKI
LHIQTHEKLIRDSQEKPKPVPDKENKKLLCGKCKALVCYTADIRVIEECHYTVLGDAFKE
CFVRRPHPKPKKFSNFDKREKIFCARQNCSHDWGIHMKYKTFEIPVIKIESFVVEDIATG
VQTLYSKWKDFHFEKIPFDPAEMAK
NT seq 2778 nt   +upstreamnt  +downstreamnt
atgactacggagcagcggcgcagcctgctagccttccaggattatatccggaagaccctg
gaccctacctacatcctgagctacatggccccctggtttagggaggaagaggtgcagtat
attcaggctgagaaaaacaacaagggcccaatggaggctgccacactttttctcaagttc
ctgttggagctccaggaggaaggctggttccgtggctttttggatgccctagaccatgca
ggttattctggactttatgaagccattgaaagttgggatttcaaaaaaattgaaaagttg
gaggagtatagattacttttaaaacgtttacaaccagaatttaaaaccagaattattcca
acagatatcctttctgatctgtctgaatgtttaattaatcaggaatgtgaagaaattcta
cagatttgctccactaaggggatgatggcaggtgcagagaaattggtggaatgccttctc
agatcagacaaggagaactggcccaaaactttgaaacttgctttggagagagagaggaac
aagttcagtgaactgtggactgtagagaaaggtataaaagatgttgaaacagaagatctt
gaggataagatggaaacttctgacatacagattttctaccaagaagatccagaatgccag
aatcttagtgagaattcatgtctaccttcagaagtgtctgatacaaacttgtacagccca
tttaaactaagaaattaccaattagagcttgctttgcctgctaagaaaggaaaaaacaca
ataatatgtgctcctacaggttgtggaaaaaccctggttgcagtccttatatgtgaacat
catcttaaaaaattcccaccaggacaaaaggggaaagttgtcttttttgcaaatcagatc
ccagtatatgaacagcaggaatctgtattctcaaaatactttgaaagacttgggtataga
gttacaggcatttctggagcaacagctgagaatgtaccagtggaacagattgttgaaaac
aatgacatcatcattttaactccgcagattcttgtgaacaaccttaaaaagggaacgatt
ccatcactgtccgtctttactttgatgatatttgatgaatgccacaacaccagtaaacaa
cacccatacaatatgatcatgtttaattatctagatcagaaacttggaggatcttcaggc
ccactgccccaggtcattgggctgactgcctcggttggtgttggggatgccaaagacaca
gatgaagccttggattatatctgcaagctgtgtgcttctcttgatgcgtcagtgatagca
acagtcaaagacaacctggaggaactggagcaagttgtttataagccccagaagtttttc
aggaaagtggaatcacgggttagcgacaaatttaaatgcatcatagctcagctgatgagg
gacacagagagtctggcgaagagaatctgcaaagacctcgaaagcttttctcaaattcaa
aatagggaatttggaacacagaaatatgaacaatggattgttacagttcaaaaggcatgc
atggtgttccagatgccagacaaagatgaagagagcaggatttgtaaagccctgttttta
tacacttcacatttgcggaaatataatgatgccctcattatcagtgagcacgcacgactg
aaagatgctttggattacctgaaagacttcttcagcaatgttcgagcagcaggatttgat
gagactgagcaagatcttactcagaggtttgaagaaaagctgcaggaactagaaagtgtt
tccagggatcccagcaatgagaaccctaaacttgaagacctctgcttcatcttacaagaa
gagtaccacttaaacccagagacaatcacaattctctttgtgaaaaccagagcacttgtg
gatgctttaaaaaattggattgaaggaaatcctaaactccattttctaaaacctggcata
ttgactggacgtggcaaaacaaatcagaacacaggaatgaccctcccagcacagaagtgt
atattggaagcattcaaagtcaatggagatcacaatattctgattgccacctcagttgct
gatgaaggcattgacattgcacagtgcaatcttgtcatcctgtatgagtatgtgggcaat
gtcatcaaaatgatccaaaccagaggcagaggaagagcaagaggtagcaagtgcttcctt
ctgactagtaatgctggtgtaattgaaaaagaacaaataaacatgtacaaagaaaaaatg
atgaatgactgtattttacaccttcagacatgggatgaagcagtatttagggaaaagatt
ctgcatatacagactcatgaaaaattaatcagagatagtcaagaaaaaccaaaacctgta
cctgataaggaaaataaaaaactgctctgcggaaagtgcaaagccttggtatgttacaca
gctgacataagagtgatagaggaatgccattacactgtgcttggagatgcttttaaggaa
tgctttgtgaggagaccacatcccaagccaaagaagttttcaaattttgataaaagagaa
aagatattctgtgcccgacagaactgcagccatgactggggaatccatatgaagtacaag
acatttgagattccagttataaaaattgaaagttttgtggtggaggatattgcaactgga
gttcagacactgtactcgaagtggaaggactttcattttgagaagataccatttgatcca
gcagaaatggccaaatga

DBGET integrated database retrieval system