KEGG   Macaca mulatta (rhesus monkey): 704823
Entry
704823            CDS       T01028                                 

Gene name
ALK
Definition
(RefSeq) ALK tyrosine kinase receptor isoform X1
  KO
K05119  anaplastic lymphoma kinase [EC:2.7.10.1]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc05200  Pathways in cancer
mcc05223  Non-small cell lung cancer
mcc05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    704823 (ALK)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    704823 (ALK)
  09162 Cancer: specific types
   05223 Non-small cell lung cancer
    704823 (ALK)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcc01001]
    704823 (ALK)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mcc04090]
    704823 (ALK)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     704823 (ALK)
Protein kinases [BR:mcc01001]
 Receptor tyrosine kinases (RTK)
  ALK family
   704823 (ALK)
CD molecules [BR:mcc04090]
 Proteins
  704823 (ALK)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase MAM Gly_rich Ldl_recept_a Nup96
Other DBs
NCBI-GeneID: 704823
NCBI-ProteinID: XP_014967517
LinkDB
Position
13
AA seq 1620 aa
MGTIGLLWLLPLLLSTAALGSGTGTGQRTGSPAAGPPLQPREPLSYSRLQRKSLAVDFVV
PSLFRVYARDLLLPPSPSELKAGRPEARGSLALDCAPLLRLLGPAPGVSWTAGSPTPAEA
RTLSRVLKGGSVRKLRRAKQLVLELGEEAILEGCVGPPGEAAVGLLQFNLSELFSWWIRQ
GEGRLRIRLMPEKKASEVGREGRLSAAIRASQPRLLFQIFGTGHSSLESPTNIPSPSPDY
FTWNLTWIMKDSFPFLSHRSRYGLECSFDFPCELEYSPPLHDLRNQSWSWRRVPSEEASQ
MDLLDGPEAERSKEMPRGSFLLLNTSADSKHTILSPWMRSSSEHCTLAVSVHRHLQPSGR
YIAQLLPHNEAAREILLMPTPGKHGWTVLQGRIGRPDNPFRVALEYISSGNRSLSAVDFF
ALKNCSEGTSPGSKMALQSSFTCWNGTVLQLGQACDFHQDCAQGEDESQICRKLPVGFYC
NFEDGFCGWTQGTLSPHTPQWQVRTLKDARFQDHQDHALLLSTTDAPTSESATVTSATFP
APIKSSPCELRMSWLIRGVLRGNVSLVLVENKTGKEQGRMVWHVAAYEGLSLWQWTVLPL
LDVSDRFWLQMVAWWGQGSRAIVAFDNISISLDCYLTISGEDKILQNTAPKSRNLFERNP
NKELKPGENSPRQTPIFDPTVHWLFTTCGASGPHGPTQAQCNNAYQNSNLSVEVGSEGPL
KGIQIWKVPATDTYSISGYGAAGGKGGKNTMMRSHGVSVLGIFNLEKDDTLYILVGQQGE
DACPSTNQLIQKVCIGENNVIEEEIRVNRSVHEWAGGGGGGGGATYVFKMKDGVPVPLII
AAGGGGRAYGAKTDAFHPERLENNSSVLGLNGNSGAAGGGGGWNDNTSLLWAGKSLLEGA
TGGHSCPQAMKKWGWETRGGFGGGGGGCSSGGGGGGYIGGNAASNNDPEMDGEDGVSFIS
PLGILYTPALKVMEGHGEVNIKHYLNCSHCEVDECHMDTESHKVICFCDHGTVLAEDGVS
CIVSPTPEPHLPLSLILSVVTSALVAALVLAFSGIMIVYRRKHQELQAMQMELQSPEYKL
SKLRTSTIMTDYNPNYCFAGKTSSISDLKEVPRKNITLIRGLGHGAFGEVYEGQVSGVPN
DPSPLQVAVKTLPEVCSEQDELDFLMEALIISKFNHQNIVRCIGVSLQALPRFILLELMA
GGDLKSFLRETRPRPSQPSSLAMLDLLHVARDIACGCQYLEENHFIHRDIAARNCLLTCP
GPGRVAKIGDFGMARDIYRASYYRKGGCAMLPVKWMPPEAFMEGIFTSKTDTWSFGVLLW
EIFSLGYMPYPSKSNQEVLEFVTSGGRMDPPKNCPGPVYRIMTQCWQHQPEDRPNFAIIL
ERIEYCTQDPDVINTALPIEYGPLVEEEEKVPVRPKDPEGVPPLLVSQQAKRGEERSPAA
PPPVPTTSSGKAAKKPTAAEVSVRVPRGPAVEGGHVNMAFSQSNPPSELHKVQGSRNKPT
SLWNPTYGSWFTEKPTKKNNPLAKKEPHERGNLGLEGSCTVPPNVATGRLPGASLLLEPS
SLTANMKEVPLFRLRHFPCGNVNYGYQQQGLPLEAATAPGAGHYEDTILKSKNSMNQPGP
NT seq 4863 nt   +upstreamnt  +downstreamnt
atgggaaccatcgggctcctgtggctgctgccgctgctgctttccactgcagctttgggc
tctgggacggggaccggccagcgcacgggatccccagctgcggggccgccgctgcagccc
cgggagccgctcagctactctcgcctgcagaggaagagtctggcagtggacttcgtagtg
ccctcactcttccgtgtctatgcccgggacctgctgctgccgccatccccctcggagctg
aaggctggcaggcccgaggcgcgaggctcgctcgctctggactgcgccccgctgctcagg
ttgctggggccggcgcctggggtctcctggacagccggctcacccaccccggcagaggcc
cggacgctgtccagggtgctgaagggcggctcggtgcgcaagctccggcgtgccaagcag
ctggtgctggagctgggcgaggaggcgatcttggagggttgcgtcgggccccctggggag
gcggctgtggggctgctccagttcaacctcagcgagctgttcagttggtggattcgccag
ggcgaagggcgactgaggatccgcctgatgcccgagaagaaggcgtcggaagtgggcaga
gagggaaggctgtccgcggcaatccgcgcctcccagccccgccttctcttccagatcttc
gggactggtcatagctccttggagtcaccaacaaacataccttctccttctcctgattat
tttacatggaatctcacctggataatgaaagactccttccctttcctgtctcatcgcagc
cgatatggtctggagtgcagctttgacttcccctgtgagctggaatattcccctccactg
cacgacctcaggaaccagagctggtcctggcgccgtgttccctccgaggaggcctcccag
atggacttgctggatgggcctgaggcagagcgttctaaggagatgcccagagggtccttt
ctcctcctcaacacctcagctgactccaagcacaccatcctaagtccgtggatgaggagc
agcagtgagcactgtacgctggccgtctcagtgcacaggcacctgcagccctctggaagg
tacattgcccagctgctgccccacaacgaggctgcaagagagatcctcctgatgcccacc
ccagggaagcatggttggacagtgctccagggaagaatcgggcgcccagacaaccccttt
cgagtggccctggaatacatctccagtggaaaccgcagcttgtctgcagtggacttcttt
gccctgaagaactgcagtgaaggaacatccccaggctccaagatggccctgcagagctcc
ttcacttgttggaatgggacagtcctccagcttgggcaggcctgtgacttccaccaggac
tgcgcccagggagaagacgagagccagatatgccggaaactccctgtgggtttttactgc
aacttcgaagatggcttctgtggctggacccaaggcacactctcacctcacactcctcag
tggcaggtcaggactctaaaggatgcccggttccaggaccaccaagaccatgctctattg
ctcagtaccactgatgcccccacttcagaaagtgctacagtgaccagtgctacgtttccc
gcaccgatcaagagctctccatgtgagctccgaatgtcctggctcattcgtggagtcctg
aggggaaacgtgtccttggtgctagtggagaacaaaactgggaaggagcaaggcaggatg
gtctggcatgtcgccgcctatgaaggcttgagcctgtggcagtggacggtgttgcctctc
ctcgacgtgtctgacaggttctggctgcagatggttgcatggtggggacaaggatccaga
gccatcgtggcttttgacaatatttccatcagcctggactgctacctcaccattagtgga
gaggacaagatcctacagaatacagcacccaaatcaagaaacctgtttgagagaaaccca
aacaaggagctgaaacccggggaaaattcaccacgacagacgcccatctttgaccctaca
gttcattggctgttcaccacatgtggggccagcggaccccatggtcccacccaggcgcag
tgcaacaacgcctaccagaactccaacctgagcgtggaggtgggaagcgagggccccctg
aagggcatccagatctggaaggtgccagccaccgacacctacagcatctcgggctacgga
gctgctggcgggaaaggcgggaagaacaccatgatgcggtcccacggcgtgtctgtgctg
ggcatcttcaacctggagaaagacgacacgctgtacatcctggttgggcagcagggagag
gacgcctgccccagtacaaaccagttaatccagaaagtctgcattggagagaacaatgtg
atagaagaagaaatccgtgtgaacagaagcgtgcatgagtgggcaggaggaggaggagga
gggggtggagccacctatgtatttaagatgaaggatggagtgccggtgcccctgatcatt
gcagccggaggtggcggcagggcctatggggccaagacagacgcgttccacccagagaga
ctggagaataactcctcggttctagggctgaacggcaattccggagccgcaggtggtgga
ggtggctggaatgataacacttccttgctctgggccggaaaatctttgctggagggtgcc
accggaggacattcctgcccccaggccatgaagaagtgggggtgggagacaagagggggt
ttcggagggggtggaggggggtgctcctcaggtggaggaggcggaggatatataggcggc
aatgcagcctcaaacaatgaccccgaaatggatggggaagatggggtttccttcatcagt
ccactgggcatcctgtacaccccagctttaaaagtgatggaaggccatggggaagtgaat
attaagcattatctaaactgcagtcactgtgaggtagacgaatgtcacatggacactgaa
agccacaaggtcatctgcttctgtgaccacgggacagtgctggcagaggatggcgtctcc
tgcattgtgtcgcccaccccggagccgcacctgccactctcactgatcctctccgtggtg
acctctgccctcgtggctgccctggtcctggctttctccggcatcatgattgtgtaccgc
cggaagcaccaggagctgcaagccatgcagatggagctgcagagccctgagtacaagctg
agtaagctccgcacctcaaccatcatgaccgactacaaccccaactactgctttgctggc
aagacctcctccatcagtgacctgaaggaggtgccgcggaaaaacatcaccctcattcgg
ggtctgggccatggcgcctttggggaggtgtatgaaggccaggtgtccggagtgcccaac
gacccaagccccctgcaagtggctgtgaagacgctgcctgaggtgtgctcagaacaggac
gaactggatttcctcatggaagccctgatcatcagcaaattcaaccaccagaacatcgtt
cgctgcatcggggtgagcctgcaggccctgccccggttcatcctactggagctcatggca
ggaggagacctcaagtccttcctccgagagacccgccctcgcccgagccagccctcctcc
ctggccatgctggaccttctgcatgtggctcgggacattgcctgtggctgtcagtatttg
gaggaaaaccacttcatccaccgagacattgctgccagaaactgcctcttgacctgtcca
ggccctggaagagtggccaagattggagacttcgggatggcccgagacatctacagggcg
agctactacagaaagggaggctgtgcgatgctgccagttaagtggatgcccccagaggcc
ttcatggaaggaatattcacctctaaaacagacacatggtcctttggagtgctgctgtgg
gaaatcttttctctcggatatatgccatatcccagcaaaagcaaccaggaagttctggag
ttcgtcaccagtggaggccggatggacccacccaagaactgccctgggcctgtataccgg
ataatgactcagtgctggcaacatcagcctgaagacaggcccaactttgccatcattttg
gagaggattgaatactgcacccaggacccagatgtaatcaacactgctttgccgatagaa
tacggtccacttgtagaagaggaagagaaagtacccgtgaggcccaaggaccctgagggg
gttcctcctctcctggtctctcaacaggcgaaacggggggaggagcgcagcccagctgcc
ccaccacctgtgcctaccacctcctctggcaaggctgcaaagaaacccacagctgcagag
gtctctgttcgagtccctagagggccggccgtggaagggggacacgtgaatatggcattc
tctcagtccaaccccccttcggagttgcacaaggtccagggatccagaaacaagcccacc
agcttgtggaacccaacgtacggctcctggtttacagagaaacccaccaaaaagaataat
cctctagcaaagaaggagccacatgagagaggtaacctagggctggagggaagctgtact
gtcccacctaacgttgcaactgggagacttccgggggcctcactgctcctagagccctct
tcgctgactgccaacatgaaggaggtacctctgttcaggctacgtcacttcccttgtggg
aatgtcaattacggctaccagcaacagggcttgcccttagaagccgctactgcccccgga
gctggtcattacgaggacaccattctgaaaagcaagaatagcatgaaccagcctgggccc
tga

KEGG   Macaca mulatta (rhesus monkey): 715091
Entry
715091            CDS       T01028                                 

Gene name
EML4
Definition
(RefSeq) echinoderm microtubule-associated protein-like 4 isoform X1
  KO
K15420  echinoderm microtubule-associated protein-like 4
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc05200  Pathways in cancer
mcc05223  Non-small cell lung cancer
mcc05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    715091 (EML4)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    715091 (EML4)
  09162 Cancer: specific types
   05223 Non-small cell lung cancer
    715091 (EML4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mcc04812]
    715091 (EML4)
Cytoskeleton proteins [BR:mcc04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    EMAP
     715091 (EML4)
SSDB
Motif
Pfam: WD40 HELP ANAPC4_WD40 SlyX Ribosomal_S7
Other DBs
NCBI-GeneID: 715091
NCBI-ProteinID: XP_014967716
Ensembl: ENSMMUG00000016277
LinkDB
Position
13
AA seq 991 aa
MDGFAGSLDDSISAASTSDVQDRLSALESRVQQQEDEITVLKAALADVLRRLAISEDHVA
SVKKSVSSKGQPSPRAAIPMSCITNGSGANRKPSHTSTVSIAGKETLSSAAKSGTEKKKE
KPQGQREKKEESHSNDQSPQIRASPSPQPSSQPLQIHRQTPESKNATPTKSIKRPSPAEK
SHNSWENSDDSRNKLSKIPSTPKLIPKVTKNTDKHKDVIINQAKMSTREKNSQEGEYIKM
FMRGRPITMFIPSDVDNYDDIRTELPSEKLKLEWAYGYRGKDCRANVYLLPTGEIVYFIA
SVVVLFNYEERTQRHYLGHTDCVKCLAIHPDKIRIATGQIAGVDKDGRPLQPHVRVWDSV
TLSTLQIIGLGTFERGVGCLDFSKADSGVHLCVIDDSNEHMLTVWDWQKKAKGAEIKTTN
EVVLAVEFHPTDANTIITCGKSHIFFWTWSGNSLTRKQGIFGKYEKPKFVQCLAFLGNGD
VLTGDSGGVMLIWSKTTVEPTPGKGPKGVYQISKQIKAHDGSVFTLCQMRNGMLLTGGGK
DRKIILWDHDLNPEREIEVPDQYGTIRAVAEGKADQFLVGTSRNFILRGAFNDGFQIEVQ
GHTDELWGLATHPFKDLLLTCAQDRQVCLWNSMEHRLEWTRLVDEPGHCADFHPSGTVVA
IGTHSGRWFVLDAETRDLVSIHTDGNEQLSVMRYSIDGTFLAVGSHDNFIYLYVVSENGR
KYSRYGRCTGHSSYITHLDWSPDNKYIMSNSGDYEILYWDIPNGCKLIRNRSDCKDIDWT
TYTCVLGFQVFGVWPEGSDGTDINALVRSHNRKVIAVADDFCKVHLFQYPCSKAKAPSHK
YSAHSSHVTNVSFTHNDSHLISTGGKDMSIIQWKLVEKLSLPQNETVADTTLTKAPVSST
ESVIQSDTPTPPPSQSLNETAEEESRISSSPTLLENSLEQTVEPSEDHSEEESEGGSGDL
GEPLYEEPSNEISKQGEATLPEDQQDPLPSS
NT seq 2976 nt   +upstreamnt  +downstreamnt
atggacggtttcgccggcagcctcgatgatagtatttctgctgcaagtacttctgatgtt
caagatcgcctgtcagctcttgagtcacgagttcagcaacaagaagacgaaatcactgtg
ctgaaggcagctttggctgatgttttgaggcgtcttgcaatctctgaagatcatgtggcc
tcagtgaaaaaatcagtctcaagtaaaggccaaccaagccctcgagcagctattcccatg
tcctgtataaccaatggaagtggtgcaaacagaaaaccaagtcataccagcactgtctca
attgcaggaaaagaaactctttcatctgctgctaaaagtggtacagaaaaaaagaaagaa
aaaccacaaggacagagagaaaaaaaagaggaatctcattctaatgatcaaagtccacaa
attcgagcatcaccttctccccagccctcttcacaacctctccaaatacacagacaaact
ccagaaagcaagaatgctactcccaccaaaagcataaaacgaccatcaccagctgaaaag
tcacacaattcatgggaaaattcagatgatagccgtaataaattgtcgaaaataccttca
acacccaaattaataccaaaagttaccaaaaatacagacaagcataaagatgtcatcatc
aaccaagcaaaaatgtcaactcgtgaaaaaaacagccaagaaggagaatatattaaaatg
tttatgcgcggtcggccaattaccatgttcattccttctgatgttgacaactatgatgac
atcagaacagaactgccttctgagaagctcaaactggagtgggcatatggttatcgagga
aaggactgtagagctaatgtttaccttcttccgaccggggaaatagtttatttcattgca
tcagtggtagtactatttaattatgaggagagaactcaacgacactatctgggtcataca
gactgtgtgaaatgccttgctatacatcctgacaaaattaggattgcaactggacagata
gctggcgtggataaagatggaaggcctctacaaccccacgtcagagtgtgggattctgtt
actctctccacactgcagattattggacttggcacttttgagcgtggagtaggatgcctg
gatttttcaaaagcagattcaggtgttcatttatgtgttattgatgactccaatgaacat
atgcttactgtatgggactggcagaaaaaagcaaaaggagcagaaataaagacaacaaat
gaagttgttttggctgtggagtttcacccaacagatgcaaataccataattacgtgcggt
aaatctcatattttcttctggacctggagtggcaattcactaacaagaaaacagggaatt
tttgggaaatatgaaaagccaaaatttgtgcagtgtttagcattcttggggaatggagat
gttcttactggagactcaggtggagtcatgcttatatggagcaaaactactgtagagccc
acacctgggaaaggacctaaaggtgtatatcaaatcagcaaacaaatcaaagctcatgat
ggcagtgtgttcacactttgtcagatgagaaatgggatgttattaactggaggagggaaa
gacagaaaaataattctgtgggatcacgatctgaatcctgaaagagaaatagaggttcct
gatcagtatggcacaatcagagctgtagcagaaggaaaggcagatcaatttttagtaggc
acatcacgaaactttattttacggggagcatttaatgatggcttccaaatagaagtacag
ggtcatacagatgagctttggggtcttgctacacatcccttcaaagatttgctcttgaca
tgtgctcaggacaggcaggtgtgcctgtggaactcaatggaacacaggctggaatggacc
aggctggtagatgaaccaggacactgtgcagattttcatccaagtggcacagtggtggcc
ataggaacgcactcaggcaggtggtttgttctggatgcagaaaccagagatctagtttct
atccacacagacgggaatgaacagctctctgtgatgcgctactcaatagatggtaccttc
ctggctgtaggatctcatgacaactttatttacctctatgtagtctctgaaaatggaaga
aaatatagcagatatggaaggtgcactggacattccagctacatcacacaccttgactgg
tccccagacaacaagtatataatgtctaactcgggagactatgaaatattgtactgggac
attccaaatggctgcaaactaatcaggaatcgatcggattgtaaggacattgattggacg
acatatacctgtgtgctaggatttcaagtctttggtgtctggccagaaggatctgatggg
acagatatcaatgccctggtgcgatcccacaatagaaaggtgatagctgttgccgatgac
ttttgtaaagtccatctgtttcagtatccctgctccaaagcaaaggctcccagccacaag
tacagtgcccacagcagccatgtcaccaacgtcagttttacacacaacgacagtcacctg
atatcaactggtggaaaagacatgagcatcattcagtggaaacttgtggaaaagttatct
ttgcctcagaatgagactgtagcggatactactctaaccaaagcccccgtctcttccact
gaaagtgtcatccaatctgatactcccacaccgcctccttctcagtccttaaatgagaca
gctgaagaggaaagtagaataagcagttctcccacacttctggagaacagcctggaacaa
actgtggagccaagcgaagaccacagcgaggaggagagtgaagggggcagcggagacctt
ggtgagcctctttatgaagagccatccaatgagataagcaagcagggcgaagccaccctt
ccagaggaccagcaagaccctttgccctcgtcctaa

DBGET integrated database retrieval system