KEGG   Macaca mulatta (rhesus monkey): 704871
Entry
704871            CDS       T01028                                 

Gene name
RB1
Definition
(RefSeq) retinoblastoma-associated protein
  KO
K06618  retinoblastoma-associated protein
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc01522  Endocrine resistance
mcc04110  Cell cycle
mcc04218  Cellular senescence
mcc04934  Cushing syndrome
mcc05160  Hepatitis C
mcc05161  Hepatitis B
mcc05163  Human cytomegalovirus infection
mcc05165  Human papillomavirus infection
mcc05166  Human T-cell leukemia virus 1 infection
mcc05167  Kaposi sarcoma-associated herpesvirus infection
mcc05169  Epstein-Barr virus infection
mcc05200  Pathways in cancer
mcc05203  Viral carcinogenesis
mcc05212  Pancreatic cancer
mcc05214  Glioma
mcc05215  Prostate cancer
mcc05218  Melanoma
mcc05219  Bladder cancer
mcc05220  Chronic myeloid leukemia
mcc05222  Small cell lung cancer
mcc05223  Non-small cell lung cancer
mcc05224  Breast cancer
mcc05225  Hepatocellular carcinoma
mcc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    704871 (RB1)
   04218 Cellular senescence
    704871 (RB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    704871 (RB1)
   05203 Viral carcinogenesis
    704871 (RB1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    704871 (RB1)
   05225 Hepatocellular carcinoma
    704871 (RB1)
   05226 Gastric cancer
    704871 (RB1)
   05214 Glioma
    704871 (RB1)
   05220 Chronic myeloid leukemia
    704871 (RB1)
   05218 Melanoma
    704871 (RB1)
   05219 Bladder cancer
    704871 (RB1)
   05215 Prostate cancer
    704871 (RB1)
   05224 Breast cancer
    704871 (RB1)
   05222 Small cell lung cancer
    704871 (RB1)
   05223 Non-small cell lung cancer
    704871 (RB1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    704871 (RB1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    704871 (RB1)
   05161 Hepatitis B
    704871 (RB1)
   05160 Hepatitis C
    704871 (RB1)
   05163 Human cytomegalovirus infection
    704871 (RB1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    704871 (RB1)
   05169 Epstein-Barr virus infection
    704871 (RB1)
   05165 Human papillomavirus infection
    704871 (RB1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    704871 (RB1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mcc01009]
    704871 (RB1)
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mcc03000]
    704871 (RB1)
Protein phosphatases and associated proteins [BR:mcc01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     704871 (RB1)
Transcription factors [BR:mcc03000]
 Eukaryotic type
  Other transcription factors
   Pocket domain Rb
    704871 (RB1)
SSDB
Motif
Pfam: Rb_C RB_A RB_B DUF3452
Other DBs
NCBI-GeneID: 704871
NCBI-ProteinID: NP_001247976
Ensembl: ENSMMUG00000007891
UniProt: I2CVJ1
LinkDB
Position
17
AA seq 928 aa
MPPKTPRKTAAAAAAAAAEPPAPPPPPPPEEDPEQDSGPEDLPLVRLEFEETEEPDFTAL
CQKLKIPDHVRERAWLTWEKVSSVDGVLGGYIQKKKELWGICIFIAAVDLDEMPFTFTEL
QKNIEISVHKFFNLLKEIDTSTKVDNAMSRLLKKYDVLFALFSKLERTCELIYLTQPSSS
ISTEINSTLVLKVSWITFLLAKGEVLQMEDDLVISFQLMLCVLDYFIKLSPPVLLKEPYK
TAVIPINGSPRTPRRGQNRSARIAKQLENDTRIIEVLCKEHECNIDEVKNVYFKNFIPFM
NSLGLVTSNGLPEVESLSKRYEEIYLKNKDLDARLFLDHDKTLQTDSIDSFETQRTPRKS
NLDEEVNVIPPHTPVRTVMNTIQQLMMILNSASDQPSENLISYFNNCTVNPKESILKRVK
DIGYIFKEKFAKAVGQGCVEIGSQRYKLGVRLYYRVMESMLKSEEERLSIQNFSKLLNDN
IFHMSLLACALEVVMATYSRSTSQNLDSGTDLSFPWILNVLNLKAFDFYKVIESFIKAEG
NLTREMIKHLERCEHRIMESLAWLSDSPLFDLIKQSKDREGPTDHFESACPLNLPLQNNH
TAADMYLSPVRSPKKKGSTTRVNSTANAETQATSAFQTQKPLKSTSLSLFYKKVYRLAYL
RLNTLCERLLSEHPELEHIIWTLFQHTLQNEYELMRDRHLDQIMMCSMYGICKVKNIDLK
FKIIVTAYKDLPHAVQETFKRVLIKEEEYDSIIVFYNSVFMQRLKTNILQYASTRPPTLS
PIPHIPRSPYKFPSSPLRIPGGNIYISPLKSPYKISEGLPTPTKMTPRSRILVSIGESFG
TSEKFQKINQMVCNSDRVLKRSAEGSNPPKPLKKLRFDIEGSDEADGSKHLPGESKFQQK
LAEMTSTRTRMQKQKMNDSMDTSNKEEK
NT seq 2787 nt   +upstreamnt  +downstreamnt
atgccgcccaaaaccccccgaaaaacggccgccgccgccgccgccgctgccgcggaaccc
ccggcaccgccgccgccaccccctcctgaggaggacccagagcaggacagcggtccggag
gacctgcctctggtcaggcttgagtttgaagaaaccgaagaacctgattttactgcgtta
tgtcagaaattaaagataccagatcatgtcagagagagagcttggttaacttgggagaaa
gtttcatctgtggatggagtattgggaggttatattcaaaagaaaaaagaactgtgggga
atatgtatctttattgcagcagttgacctagatgagatgccattcacttttactgagcta
cagaaaaacatagaaatcagtgtccataaattctttaacttactaaaggaaattgatact
agtaccaaagttgataatgctatgtcaagactattgaagaagtatgatgtattgtttgca
ctcttcagcaaattggaaaggacatgtgaacttatatatttgacacaacccagcagttcg
atatctactgaaataaattctacattggtgctaaaagtttcttggatcacatttttatta
gctaaaggggaagtattacaaatggaagatgatctggtgatttcatttcagttaatgcta
tgtgtccttgactattttattaaactctcacctcctgtgttgctcaaagaaccatataaa
acagctgttatacccattaatggttcacctcgaacacccaggcgaggccagaacaggagt
gcacggatagcaaaacaactagaaaatgatacaagaattattgaagttctctgtaaagaa
catgaatgtaatatagatgaggtgaaaaatgtttatttcaaaaattttataccttttatg
aattctcttggacttgtaacatctaatggacttccagaggttgaaagtctgtctaaacga
tatgaagaaatttatcttaaaaataaagatctagatgcaagattatttttggatcatgat
aagactcttcagactgattctatagacagttttgaaacacagagaacaccgcgaaaaagt
aaccttgatgaagaggtgaatgtgattcctccacacactccagttaggactgttatgaac
actatccaacaattaatgatgattttaaattcagcaagtgatcaaccttcagaaaatctg
atttcctattttaataactgcacagtgaatccaaaagaaagcatactgaaaagagtgaag
gatataggatacatctttaaagagaaatttgctaaagctgtgggacagggatgtgtcgaa
attggatcacagcgatacaaacttggagttcgcttgtattaccgagtaatggaatccatg
cttaaatcagaagaagaacgattatccattcaaaattttagcaaacttctgaatgacaac
atttttcatatgtctttattggcgtgtgctcttgaggttgtaatggccacatatagcaga
agtacatctcagaatcttgattctggaacagatttgtctttcccatggattctgaatgtg
cttaatttgaaagcctttgatttttacaaagtgattgaaagttttatcaaagcagaaggc
aacttgacaagagaaatgataaaacacttagaacgatgtgaacatcgaatcatggaatcc
cttgcatggctctcagattcacctttatttgatcttattaaacaatcaaaggaccgagaa
ggaccaactgatcactttgaatctgcttgtcctcttaatcttcctctccagaataatcac
actgcagcagatatgtatctttctcctgtaagatctccaaagaaaaaaggttcaactaca
cgtgtaaattctactgcaaatgcagagacacaagcaacctcagccttccagacccagaag
ccattgaaatctacctctctttcactgttttataaaaaagtgtatcggctagcctatctc
cggctaaatacactatgtgaacgccttctatctgagcacccagaactagaacacatcatc
tggacccttttccagcatacgctgcagaatgagtatgaactcatgagagacaggcatttg
gaccaaattatgatgtgttccatgtatggcatatgcaaagtgaagaatatagaccttaaa
ttcaaaatcatcgtaacagcatacaaggatcttcctcatgctgttcaggagacattcaaa
cgtgttttgatcaaagaagaggagtatgattctattatagtattctataactcggtcttc
atgcagagactgaaaacaaatattttgcagtatgcttccaccaggccccctaccttgtca
ccaatacctcacattcctcgaagtccttacaagtttcctagttcgcccttacggattcct
ggagggaacatctatatttcacccctgaagagtccatataaaatttcagaaggtctgcca
acaccaacgaaaatgactccaagatcaagaatcttagtatcaattggtgaatcatttggg
acttctgagaagttccagaaaataaatcagatggtgtgtaacagcgaccgtgtgctcaaa
agaagtgctgaaggaagcaaccctcctaaaccgctgaaaaaactacgctttgatattgaa
ggatcagatgaagcagatggaagtaaacatctcccaggggagtccaaatttcagcagaaa
ctggcagaaatgacttccactcgaacacgaatgcaaaagcagaaaatgaatgatagcatg
gatacctcaaacaaggaagagaaatga

DBGET integrated database retrieval system