KEGG   Macaca mulatta (rhesus monkey): 705195
Entry
705195            CDS       T01028                                 

Gene name
MAP2K3
Definition
(RefSeq) dual specificity mitogen-activated protein kinase kinase 3
  KO
K04432  mitogen-activated protein kinase kinase 3 [EC:2.7.12.2]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04010  MAPK signaling pathway
mcc04015  Rap1 signaling pathway
mcc04218  Cellular senescence
mcc04620  Toll-like receptor signaling pathway
mcc04664  Fc epsilon RI signaling pathway
mcc04668  TNF signaling pathway
mcc04714  Thermogenesis
mcc04750  Inflammatory mediator regulation of TRP channels
mcc04912  GnRH signaling pathway
mcc04935  Growth hormone synthesis, secretion and action
mcc05014  Amyotrophic lateral sclerosis
mcc05022  Pathways of neurodegeneration - multiple diseases
mcc05132  Salmonella infection
mcc05135  Yersinia infection
mcc05145  Toxoplasmosis
mcc05161  Hepatitis B
mcc05169  Epstein-Barr virus infection
mcc05170  Human immunodeficiency virus 1 infection
mcc05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    705195 (MAP2K3)
   04015 Rap1 signaling pathway
    705195 (MAP2K3)
   04668 TNF signaling pathway
    705195 (MAP2K3)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    705195 (MAP2K3)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    705195 (MAP2K3)
   04664 Fc epsilon RI signaling pathway
    705195 (MAP2K3)
  09152 Endocrine system
   04912 GnRH signaling pathway
    705195 (MAP2K3)
   04935 Growth hormone synthesis, secretion and action
    705195 (MAP2K3)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    705195 (MAP2K3)
  09159 Environmental adaptation
   04714 Thermogenesis
    705195 (MAP2K3)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    705195 (MAP2K3)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    705195 (MAP2K3)
   05022 Pathways of neurodegeneration - multiple diseases
    705195 (MAP2K3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    705195 (MAP2K3)
   05135 Yersinia infection
    705195 (MAP2K3)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    705195 (MAP2K3)
   05161 Hepatitis B
    705195 (MAP2K3)
   05169 Epstein-Barr virus infection
    705195 (MAP2K3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    705195 (MAP2K3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcc01001]
    705195 (MAP2K3)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     705195 (MAP2K3)
Protein kinases [BR:mcc01001]
 Serine/threonine kinases: STE group
  STE7 family
   705195 (MAP2K3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Seadorna_VP7 Pkinase_fungal APH Choline_kinase RIO1 DUF4344
Other DBs
NCBI-GeneID: 705195
NCBI-ProteinID: NP_001252876
Ensembl: ENSMMUG00000010904
UniProt: F7GLY5
LinkDB
Position
16
AA seq 347 aa
MESPASSQPASMPQSKGKSKRKKDLRISCMSKPPAPNPTPPRNLDSRTFITIGDRNFEVE
ADDLVTISELGRGAYGVVEKVRHAQSGTIMAVKRIRATVNSQEQKRLLMDLDINMRTVDC
FYTVTFYGALFREGDVWICMELMDTSLDKFYRKVLDKNMTIPEDILGEIAVSIVRALEHL
HSKLSVIHRDVKPSNVLINKEGHVKMCDFGISGYLVDSVAKTMDAGCKPYMAPERINPEL
NQKGYNVKSDVWSLGITMIEMAILRFPYESWGTPFQQLKQVVEEPSPQLPADRFSPEFVD
FTAQCLRKNPAERMSYLELMEHPFFTLHKTKKTDIAAFVKEILGEDS
NT seq 1044 nt   +upstreamnt  +downstreamnt
atggagtcgcccgcctcaagccagcccgccagcatgccccagtccaaaggaaaatccaag
aggaagaaggatctacggatatcctgcatgtccaagccacccgcgcctaaccccacaccc
ccccggaacctggactcccggaccttcatcaccattggagacagaaactttgaggtggag
gctgatgacttggtgaccatctcggaactgggccgtggagcctatggggtggtggagaag
gtgcggcacgcccagagcggcaccatcatggccgtgaagcggatccgggccactgtgaac
tcacaggagcagaagcggctgctcatggacctggacatcaacatgcgcacggtcgactgc
ttctacactgtcaccttctacggggcactgttcagagagggagacgtgtggatctgcatg
gagctcatggacacatccctggacaagttctaccggaaggtgctggataaaaacatgaca
attccagaggacatccttggggagattgctgtgtctatcgtgcgggctctggagcatctg
cacagcaagctgtcggtgatccacagagatgtgaagccctccaatgtccttatcaacaag
gagggccatgtgaagatgtgtgacttcggcatcagtggttacttggtggactctgtggcc
aagacgatggatgccggctgcaagccctacatggcccctgagaggatcaacccggagctg
aaccagaagggctacaatgtcaagtccgacgtctggagcctgggcattaccatgattgag
atggccatcctgcggttcccttacgagtcctgggggaccccgttccagcagctgaagcag
gtggtggaggagccgtccccccagctcccagccgaccgtttctcccccgagtttgtggac
ttcactgctcagtgcctgaggaagaaccccgcagagcgtatgagctacctggagctgatg
gagcaccccttcttcaccttgcacaaaaccaagaagacagacatcgctgccttcgtgaag
gagatcctgggcgaagactcatag

DBGET integrated database retrieval system