KEGG   Macaca mulatta (rhesus monkey): 705270
Entry
705270            CDS       T01028                                 

Gene name
CD3G
Definition
(RefSeq) T-cell surface glycoprotein CD3 gamma chain precursor
  KO
K06452  T-cell surface glycoprotein CD3 gamma chain
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04640  Hematopoietic cell lineage
mcc04658  Th1 and Th2 cell differentiation
mcc04659  Th17 cell differentiation
mcc04660  T cell receptor signaling pathway
mcc05142  Chagas disease
mcc05162  Measles
mcc05166  Human T-cell leukemia virus 1 infection
mcc05169  Epstein-Barr virus infection
mcc05170  Human immunodeficiency virus 1 infection
mcc05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    705270 (CD3G)
   04660 T cell receptor signaling pathway
    705270 (CD3G)
   04658 Th1 and Th2 cell differentiation
    705270 (CD3G)
   04659 Th17 cell differentiation
    705270 (CD3G)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    705270 (CD3G)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    705270 (CD3G)
   05170 Human immunodeficiency virus 1 infection
    705270 (CD3G)
   05162 Measles
    705270 (CD3G)
   05169 Epstein-Barr virus infection
    705270 (CD3G)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    705270 (CD3G)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mcc04090]
    705270 (CD3G)
CD molecules [BR:mcc04090]
 Proteins
  705270 (CD3G)
SSDB
Motif
Pfam: Ig_4 Ig_5 ITAM Ig_2 Ig_3 ig KGK
Other DBs
NCBI-GeneID: 705270
NCBI-ProteinID: NP_001253854
Ensembl: ENSMMUG00000017600
UniProt: H9ZF87
LinkDB
Position
14
AA seq 181 aa
MEQGKGLTGFILAIILLQGSLAQSFEENRKLNVYNQEDGSVLLTCHVKSTNITWFKEGKM
IDILTAHKNKWNLGSNTKDPRGVYQCKGSKDKSKTLQVYYRMCQNCIELNAATILGFVFA
EIISIFFLAVGVYFIAGQDGVRQSRASDKQTLLPNDQLYQPLKDREDDQYSHLQGNQLRR
N
NT seq 546 nt   +upstreamnt  +downstreamnt
atggaacaggggaagggcctgactggcttcatcctggctatcattcttcttcaaggtagt
ttggcccaatcatttgaagaaaaccgcaagcttaacgtgtataaccaagaagatggttca
gtacttctgacttgtcatgtgaaaagcacaaatatcacatggtttaaagaagggaagatg
atagacatcctaactgcacataaaaataaatggaatctgggaagtaataccaaggaccct
cgaggggtgtatcagtgtaaaggatcaaaggacaagtcaaaaacactccaagtgtattac
agaatgtgtcagaactgcattgaactaaatgcagccaccatattgggctttgtctttgct
gaaatcatcagcattttcttccttgctgttggggtctacttcattgctggacaggatgga
gttcgccagtcaagagcttcagacaagcagactctgttgcctaatgaccagctctaccag
cccctcaaggatcgagaagatgaccagtacagtcaccttcaaggaaaccagttgaggagg
aattga

DBGET integrated database retrieval system