KEGG   Macaca mulatta (rhesus monkey): 705275
Entry
705275            CDS       T01028                                 

Gene name
AZI2
Definition
(RefSeq) 5-azacytidine-induced protein 2
  KO
K12651  5-azacytidine-induced protein 2
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04622  RIG-I-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    705275 (AZI2)
SSDB
Motif
Pfam: TBD Cnn_1N
Other DBs
NCBI-GeneID: 705275
NCBI-ProteinID: NP_001253904
Ensembl: ENSMMUG00000000056
UniProt: H9ZCC9
LinkDB
Position
2
AA seq 394 aa
MDALVEDDICILNHEKAHKRDTVTPVSIYSGDESVASHFALVTAYEDIKKRLKDSEKENS
LLKKRIRFLEEKLIARFDEETSSVGREQVNKAYHAYREVCIDRDNLKSKLDKMNKDNSES
LKVLNEQLQSKEVELLQLRTEVETQQVMRNLNTPSSNWEVEKLSCDLKIHGLEQELELMR
KECSDLKIELQKAKQTDPYQEDNLKSRDLQKLSISSDNMQHAYWELKREMSNLHLVTQVQ
AELLRKLKTSTAIKKACAPVGCSEDLGRDSTKLHLMNFTATYTRHPPLSPNGKALCHAAS
SPLPGDIKVLSEKAVLQSWTDNERSIPNDGTCFQEHSSYGRNSLSLEDNSWVFPSPPKSS
ETAFGETKSKTLPLPNLPPLHYLDQHNQNCLYKN
NT seq 1185 nt   +upstreamnt  +downstreamnt
atggatgcactggtagaagatgatatctgtattctgaatcatgaaaaagcccataagaga
gatacagtgactccagtttcaatatattcaggagatgaatctgttgcttcccattttgct
cttgtcactgcatatgaagacatcaaaaaacgacttaaggattcagagaaagagaactct
ttgttaaagaagagaataagatttttggaagaaaagctaatagctcgatttgatgaagaa
acaagttccgtgggacgagaacaagtaaataaggcctatcatgcatatcgagaggtttgc
attgatagagataatttgaagagcaaactggacaaaatgaataaagacaactctgaatct
ttgaaagtattgaatgagcagctacaatctaaagaagtagaactcctccagctgaggaca
gaggtggaaactcagcaggtgatgaggaatttaaatacaccttcatcaaactgggaggtg
gaaaagttgagctgtgacctgaagatccatggcttggaacaagagctggaactaatgaga
aaagaatgtagcgatctcaaaatagaactacagaaagccaaacagacggatccatatcag
gaagacaatctgaagagcagagatctccaaaaactaagcatttcaagtgataatatgcag
catgcatactgggaactgaagagagaaatgtctaatttacatctggtgactcaagtacaa
gctgaactactaagaaaactgaaaacctcaactgcaatcaagaaagcctgtgcccctgta
ggatgcagtgaagaccttggaagagacagcacaaaactgcacttgatgaattttactgca
acatacacaagacatcctcctctctcaccaaatggcaaagctctttgtcatgccgcatct
tcccccttaccaggagatataaaggttttatcagagaaagcagtcctccagtcatggaca
gacaatgagagatccattcctaatgatggtacatgctttcaggaacacagttcttatggc
agaaattctctttctctggaagacaattcctgggtatttccaagtcctcctaaatcaagt
gagacggcatttggggaaactaaaagtaaaactttacctttacccaaccttccaccactg
cattacttggatcagcataatcagaactgcctttataagaattaa

DBGET integrated database retrieval system