KEGG   Macaca mulatta (rhesus monkey): 705300
Entry
705300            CDS       T01028                                 

Gene name
DNM3
Definition
(RefSeq) dynamin-3 isoform X3
  KO
K01528  dynamin 1/3 [EC:3.6.5.5]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04072  Phospholipase D signaling pathway
mcc04144  Endocytosis
mcc04721  Synaptic vesicle cycle
mcc04961  Endocrine and other factor-regulated calcium reabsorption
mcc05100  Bacterial invasion of epithelial cells
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    705300 (DNM3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    705300 (DNM3)
 09150 Organismal Systems
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    705300 (DNM3)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    705300 (DNM3)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    705300 (DNM3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mcc04131]
    705300 (DNM3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcc04147]
    705300 (DNM3)
   04990 Domain-containing proteins not elsewhere classified [BR:mcc04990]
    705300 (DNM3)
Enzymes [BR:mcc01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.5  Acting on GTP to facilitate cellular and subcellular movement
    3.6.5.5  dynamin GTPase
     705300 (DNM3)
Membrane trafficking [BR:mcc04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Dynamin
    705300 (DNM3)
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    705300 (DNM3)
   RhoA-dependent endocytosis
    705300 (DNM3)
Exosome [BR:mcc04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   705300 (DNM3)
Domain-containing proteins not elsewhere classified [BR:mcc04990]
 Pleckstrin homology (PH) domain-containing proteins
  Other PH domain-containing proteins
   705300 (DNM3)
SSDB
Motif
Pfam: Dynamin_M Dynamin_N GED PH MMR_HSR1 TetR_C_27
Other DBs
NCBI-GeneID: 705300
NCBI-ProteinID: XP_001100178
Ensembl: ENSMMUG00000007273
UniProt: F7FCG5
LinkDB
Position
1
AA seq 863 aa
MGNREMEELIPLVNRLQDAFSALGQSCLLELPQIAVVGGQSAGKSSVLENFVGRDFLPRG
SGIVTRRPLVLQLVTSKAEYAEFLHCKGKKFTDFDEVRHEIEAETDRVTGMNKGISSIPI
NLRVYSPHVLNLTLIDLPGITKVPVGDQPPDIEYQIREMIMQFITRENCLILAVTPANTD
LANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYVGVVNRSQK
DIDGKKDIKAAMLAERKFFLSHPAYRHIADRMGTPHLQKVLNQQLTNHIRDTLPNFRNKL
QGQLLSIEHEVEAYKNFKPEDPTRKTKALLQMVQQFAVDFEKRIEGSGDQVDTLELSGGA
KINRIFHERFPFEIVKMEFNEKELRREISYAIKNIHGIRTGLFTPDMAFEAIVKKQIVKL
KGPSLKSVDLVIQELINTVKKCTKKLANFPRLCEETERIVANHIREREGKTKDQVLLLID
IQVSYINTNHEDFIGFANAQQRSSQVHKKTTIGNQVIRKGWLTISNIGIMKGGSKGYWFV
LTAESLSWYKDDEEKEKKYMLPLDNLKVRDVEKSFMSSKHIFALFNTEQRNVYKDYRFLE
LACDSQEDVDSWKASLLRAGVYPDKSVGNNKAENDENGQAENFSMDPQLERQVETIRNLV
DSYMSIINKCIRDLIPKTIMHLMINNVKDFINSELLAQLYSSEDQNTLMEESAEQAQRRD
EMLRMYQALKEALGIIGDISTATVSTPAPPPVDDSWIQHSRRSPPPSPTTQRRPTLSAPL
TRPTSGRGPAPAIPSPGPHSGAPPVPFRPGPLPPFPSSSDSFGAPPQVPSRPTRAPPSVP
SRRPPPSPTRPTIIRPLESSLLD
NT seq 2592 nt   +upstreamnt  +downstreamnt
atggggaaccgggagatggaggagctgatcccactggtgaaccgtctgcaggacgccttt
tcggcgctgggacagagctgcctgctggagctgccgcagatcgccgtagtgggcggccag
agcgccggcaagagctcggtgctcgagaacttcgtgggcagggactttcttcctcgcggg
tcgggcattgtaacaagacgacctcttgtgctacagcttgttacttctaaagcagaatat
gctgagtttctacattgcaaaggaaagaaatttacagattttgatgaagttcggcatgag
attgaagcagaaacagatcgcgtgactggaatgaataaaggcatttcctccatacccatt
aatttacgagtctattccccacatgtgttaaatctaacccttattgatctacctgggata
accaaagtgcccgtgggagatcagccaccagatattgagtatcagatcagagaaatgatt
atgcagttcatcacgagggagaactgtctgattttagctgttactccagccaatactgat
cttgcaaactcagatgcgctgaagctagctaaagaagttgatcctcaaggtctgagaacc
attggagttatcaccaaactggaccttatggatgaaggaacagatgccagggatgttcta
gagaacaaactgttgcctcttcgcaggggttacgtgggggtggtaaacagaagccagaag
gacatagatgggaagaaggacataaaggcagccatgttggcagagaggaagtttttcctt
tcccacccggcttacagacatatcgctgaccgaatgggaactccacacctgcagaaggtc
cttaatcagcaacttaccaaccacattcgggataccctaccaaacttcaggaacaaacta
cagggacagttgctctccatagaacacgaagtagaagcctacaaaaatttcaaaccagaa
gacccaaccaggaagaccaaagcattgctgcagatggttcagcaatttgctgtggacttt
gagaagagaattgaagggtcaggggatcaagtagataccctggaactctcaggtggtgct
aaaatcaatcgtatttttcatgaacgctttccttttgagatagtaaagatggagttcaat
gagaaagaattgcgaagagaaataagctatgcaatcaaaaacatacatggtatcaggaca
ggattgtttactccagacatggcatttgaagcgatagtcaagaaacagattgtaaagttg
aaagggccttctttgaagagtgtggatctggtaatacaagaattaatcaacactgtgaag
aagtgtaccaaaaaactggcaaacttccccaggctctgcgaggagacggaaaggattgtt
gctaaccacattcgtgagcgagaagggaagacaaaggaccaggtattgctattgattgac
attcaagtctcttacatcaacaccaaccacgaagacttcattggcttcgcaaatgctcag
cagaggagcagtcaggttcacaagaaaaccacaattggaaatcaggtgattcgcaagggg
tggctcaccatcagcaacattggcatcatgaaagggggctcgaagggatactggttcgtc
cttactgcagaaagcttgtcctggtataaagatgatgaggaaaaagaaaagaagtacatg
cttcccttggacaacctgaaagttcgggatgtggaaaagagctttatgtctagcaagcac
atctttgcactctttaatacagagcaaaggaatgtatacaaagactatcgcttccttgag
ctggcatgtgattcccaggaggatgtcgacagctggaaggcatctctgctaagagcgggg
gtctatcctgataaatcagtagggaacaacaaagctgaaaatgatgagaatggccaagca
gaaaacttttccatggacccacaattggagaggcaagtggagaccattcgcaacctcgta
gactcctacatgtccattatcaacaaatgtatccgagatctaattccaaaaacaataatg
caccttatgatcaataacgttaaagatttcataaattcagagctcctagcacagctgtat
tcttcagaggaccaaaatactctgatggaggaatctgctgagcaggctcagcgccgggat
gagatgctacgaatgtaccaagccctaaaagaagcccttgggataattggggacatcagc
acggccaccgtgtccactccggcaccccctccagtggatgattcctggatacagcactct
cgcaggtcacctcctccaagtcccacaacccaaaggaggccaacactaagtgctcccctc
acaaggcccacatctggccgaggaccagctcctgccattccctctccaggccctcactct
ggggctcccccagtcccattccgtccaggcccattacctcctttccccagcagcagtgac
tccttcggagcccctccacaagttccatctaggcccacgagggccccacccagtgtccca
agccggagaccacccccatcaccaactcgtcccactataatccgcccactagaatcctcc
ctgttagactaa

KEGG   Macaca mulatta (rhesus monkey): 713558
Entry
713558            CDS       T01028                                 

Gene name
DNM2
Definition
(RefSeq) dynamin-2
  KO
K23484  dynamin 2 [EC:3.6.5.5]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04072  Phospholipase D signaling pathway
mcc04144  Endocytosis
mcc04666  Fc gamma R-mediated phagocytosis
mcc04721  Synaptic vesicle cycle
mcc04961  Endocrine and other factor-regulated calcium reabsorption
mcc05100  Bacterial invasion of epithelial cells
mcc05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    713558 (DNM2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    713558 (DNM2)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    713558 (DNM2)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    713558 (DNM2)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    713558 (DNM2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    713558 (DNM2)
   05100 Bacterial invasion of epithelial cells
    713558 (DNM2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mcc04131]
    713558 (DNM2)
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mcc04990]
    713558 (DNM2)
Enzymes [BR:mcc01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.5  Acting on GTP to facilitate cellular and subcellular movement
    3.6.5.5  dynamin GTPase
     713558 (DNM2)
Membrane trafficking [BR:mcc04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Dynamin
    713558 (DNM2)
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    713558 (DNM2)
   RhoA-dependent endocytosis
    713558 (DNM2)
Domain-containing proteins not elsewhere classified [BR:mcc04990]
 Pleckstrin homology (PH) domain-containing proteins
  Other PH domain-containing proteins
   713558 (DNM2)
SSDB
Motif
Pfam: Dynamin_M Dynamin_N GED PH MMR_HSR1
Other DBs
NCBI-GeneID: 713558
NCBI-ProteinID: NP_001252641
Ensembl: ENSMMUG00000014677
UniProt: I2CY05
LinkDB
Position
19
AA seq 870 aa
MGNRGMEELIPLVNKLQDAFSSIGQSCHLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRG
SGIVTRRPLILQLIFSKTEYAEFLHCKSKKFTDFDEVRQEIEAETDRVTGTNKGISPVPI
NLRVYSPHVLNLTLIDLPGITKVPVGDQPPDIEYQIKDMILQFISRESSLILAVTPANMD
LANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYIGVVNRSQK
DIEGKKDIRAALAAERKFFLSHPAYRHMADRMGTPHLQKTLNQQLTNHIRESLPALRSKL
QSQLLSLEKEVEEYKNFRPDDPTRKTKALLQMVQQFGVDFEKRIEGSGDQVDTLELSGGA
RINRIFHERFPFELVKMEFDEKDLRREISYAIKNIHGVRTGLFTPDMAFEAIVKKQIVKL
KEPSLKCVDLVVSELATVIKKCAEKLSSYPRLREETERIVTTYIREREGRTKDQILLLID
IEQSYINTNHEDFIGFANAQQRSTQLNKKRAIPNQGEILVIRRGWLTINNISLMKGGSKE
YWFVLTAESLSWYKDEEEKEKKYMLPLDNLKIRDVEKGFMSNKHVFAIFNTEQRNVYKDL
RQIELACDSQEDVDSWKASFLRAGVYPEKDQAENEDGAQENTFSMDPQLERQVETIRNLV
DSYVAIINKSIRDLMPKTIMHLMINNTKAFIHHELLAYLYSSADQSSLMEESADQAQRRD
DMLRMYHALKEALNIIGDISTSTVSTPVPPPVDDTWLQSASSHSPTPQRRPVSSIHPPGR
PPAVRGPTPGPPLIPVPVGAAASFSAPPIPSRPGPQSVFANNDLFPAPPQIPSRPVRIPP
GIPPGVPSRRPPAAPSRPTIIRPAEPSLLD
NT seq 2613 nt   +upstreamnt  +downstreamnt
atgggcaaccgcgggatggaagagctgatcccgctggtcaacaagctgcaggacgccttc
agctccatcggccagagctgccacctggacctgccgcagatcgctgtggtgggcggccag
agcgccggcaagagctcggtgctggagaacttcgtgggccgggacttcctcccccgcggt
tcaggaatcgtcacccggcggcctctcattctgcagctcatcttctcgaaaacagaatat
gccgagtttttgcactgcaagtccaaaaagtttacagattttgatgaagtccggcaggag
attgaagcagagaccgatagggtgacggggaccaacaaaggcatctccccagtgcccatc
aaccttcgagtctactcgccacacgtgttgaacttgaccctcatcgacctcccgggtatc
accaaggtgcccgtgggcgaccagcctccagacatcgagtaccagatcaaggacatgatc
ctacagttcatcagccgggagagcagcctcattctggccgtcacgcctgccaacatggac
ctggccaattccgacgccctcaagctggccaaggaggtcgatccccaaggcctgcggacc
atcggtgtcatcaccaagcttgacctgatggacgagggcaccgatgccagggatgtcttg
gagaacaagttgctcccgttgagaagaggctacattggcgtggtgaaccgcagccagaag
gatattgagggcaagaaggacatccgtgcagcgctggcagctgagaggaagttcttcctc
tcccacccggcctaccggcacatggctgaccgcatgggcacaccacatctgcagaagacg
ctgaatcagcaactgaccaaccacatccgggagtcgctgccagccctgcgtagcaaacta
cagagccagctactgtccctggagaaggaggtggaggagtacaagaacttccggcccgac
gaccctacccgcaaaaccaaagccctgctgcagatggtccagcagtttggggtggatttt
gagaagaggatcgagggctcaggagatcaggtggacacactggagctctccgggggcgcc
cgaatcaatcgcatcttccacgagcggttcccatttgagctggtgaagatggagtttgac
gagaaggacttacgacgggagatcagctacgccattaagaacatccatggagtcaggacg
gggctcttcacccccgacatggcctttgaagccattgtgaaaaaacagattgtaaaactc
aaagagccgagtttgaagtgtgttgatctcgtggtctcagagctggccacggtcattaaa
aagtgtgccgagaagctcagttcctacccccggttacgagaggagacagagcgaatcgtc
accacttacatccgggaacgggaggggagaaccaaggaccagattcttctgctgatcgac
attgaacagtcctacatcaacacgaaccacgaggacttcatcgggtttgccaatgcccag
cagaggagcacgcagctgaacaagaagagagccatccccaatcagggggagatcctggtg
atccgcaggggctggttgaccatcaacaacatcagcctgatgaaggggggctccaaggag
tactggtttgtgctgactgcagagtcgctgtcctggtacaaggatgaggaggagaaagag
aagaagtacatgctgcctctggacaacctcaagatacgtgacgtggagaagggcttcatg
tccaacaagcacgtgttcgccatcttcaacacggagcagagaaacgtctacaaggacctg
cggcagatcgagctggcctgtgactcccaggaggacgtggacagctggaaggcctcgttc
ctccgagccggcgtctaccctgagaaggaccaggcagaaaacgaggacggggcccaggag
aacaccttctccatggacccccaactggagcggcaggtggagaccattcgcaacctggtg
gactcgtacgtggccattatcaacaagtccatccgcgacctcatgccaaagaccatcatg
cacctcatgatcaacaatacgaaggccttcatccaccacgagcttctggcctacctatac
tcctcagcggaccagagcagcctcatggaggagtcggccgaccaggcgcagcggcgggac
gacatgctgcgcatgtaccatgccctcaaggaggcgctcaacatcatcggcgacatcagc
accagcaccgtgtccacgcccgtacccccgcccgtcgacgacacctggctccagagcgcc
agcagccacagccccactccacagcgccgaccggtgtccagcatacacccccccggccgg
cccccagcggtgaggggccccactccagggccccccctgattcctgtgcccgtgggggca
gcagcctccttctcggcgcccccaatcccatcccggcctggaccccagagcgtgtttgcc
aacaatgacctcttcccagccccacctcagatcccatctcggccagttcggatcccccca
gggatccccccaggagtacccagcagaagaccccctgctgcgcccagccggcccaccata
atccgcccagccgagccatccctgctcgactag

KEGG   Macaca mulatta (rhesus monkey): 717697
Entry
717697            CDS       T01028                                 

Gene name
DNM1
Definition
(RefSeq) dynamin-1 isoform X1
  KO
K01528  dynamin 1/3 [EC:3.6.5.5]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04072  Phospholipase D signaling pathway
mcc04144  Endocytosis
mcc04721  Synaptic vesicle cycle
mcc04961  Endocrine and other factor-regulated calcium reabsorption
mcc05100  Bacterial invasion of epithelial cells
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    717697 (DNM1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    717697 (DNM1)
 09150 Organismal Systems
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    717697 (DNM1)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    717697 (DNM1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    717697 (DNM1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mcc04131]
    717697 (DNM1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcc04147]
    717697 (DNM1)
   04990 Domain-containing proteins not elsewhere classified [BR:mcc04990]
    717697 (DNM1)
Enzymes [BR:mcc01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.5  Acting on GTP to facilitate cellular and subcellular movement
    3.6.5.5  dynamin GTPase
     717697 (DNM1)
Membrane trafficking [BR:mcc04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Dynamin
    717697 (DNM1)
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    717697 (DNM1)
   RhoA-dependent endocytosis
    717697 (DNM1)
Exosome [BR:mcc04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   717697 (DNM1)
Domain-containing proteins not elsewhere classified [BR:mcc04990]
 Pleckstrin homology (PH) domain-containing proteins
  Other PH domain-containing proteins
   717697 (DNM1)
SSDB
Motif
Pfam: Dynamin_M Dynamin_N GED PH MMR_HSR1
Other DBs
NCBI-GeneID: 717697
NCBI-ProteinID: XP_014972215
Ensembl: ENSMMUG00000013717
LinkDB
Position
15
AA seq 868 aa
MGNRGMEDLIPLVNRLQDAFSAIGQNADLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRG
SGIVTRRPLVLQLVNATTEYAEFLHCKGKKFTDFEEVRLEIEAETDRVTGTNKGISPVPI
NLRVYSPHVLNLTLVDLPGMTKVPVGDQPPDIEFQIRDMLMQFVTKENCLILAVSPANSD
LANSDALKVAKEVDPQGQRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYIGVVNRSQK
DIDGKKDITAALAAERKFFLSHPSYRHLADRMGTPYLQKVLNQQLTNHIRDTLPGLRNKL
QSQLLSIEKEVEEYKNFRPDDPARKTKALLQMVQQFAVDFEKRIEGSGDQIDTYELSGGA
RINRIFHERFPFELVKMEFDEKELRREISYAIKNIHGIRTGLFTPDLAFEATVKKQVQKL
KEPSIKCVDMVVSELTATIRKCSEKLQQYPRLREEMERIVTTHIREREGRTKEQVMLLID
IELAYMNTNHEDFIGFANAQQRSNQMNKKKTSGNQDEILVIRKGWLTINNIGIMKGGSKE
YWFVLTAENLSWYKDDEEKEKKYMLSVDNLKLRDVEKGFMSSKHIFALFNTEQRNVYKDY
RQLELACETQEEVDSWKASFLRAGVYPERVGDKEKASETEENGSDSFMHSMDPQLERQVE
TIRNLVDSYMAIVNKTVRDLMPKTIMHLMINNTKEFIFSELLANLYSCGDQNTLMEESAE
QAQRRDEMLRMYHALKEALSIIGDINTTTVSTPMPPPVDDSWLQVQSVPAGRRSPTSSPT
PQRRAPAVPPARPGSRGPAPGPPPAGSALGGAPPVPSRPGASPDPFGPPPQVPSRPNRAP
PGVPSRKGPASPTRPAAPRPAEAPLLDL
NT seq 2607 nt   +upstreamnt  +downstreamnt
atgggcaaccgcggcatggaagatctcatccccctggtcaaccggctgcaagacgccttc
tctgccatcggccagaacgcggacctcgacctgccgcagatcgccgtggtgggcggccag
agcgccggcaagagctcggtgctcgagaatttcgtaggcagggacttcctgcctcgagga
tctggcattgtcacccgacgtcccctggtcttgcagctggtcaatgcaaccacagaatat
gccgagttcctgcactgcaagggaaagaaattcaccgacttcgaggaggtgcgccttgag
atcgaggccgagaccgaccgggtcaccggcaccaacaagggcatctcgccggtgcctatc
aacctccgcgtctactcgccgcatgtgctgaacctgaccctggtggacctgcccggaatg
accaaggtcccggtgggggaccaacctcccgacatcgagttccagatccgggacatgctg
atgcagtttgtcaccaaggagaactgcctcatcctggccgtgtcccctgccaactctgac
ctggccaattctgacgccctcaaggtcgccaaggaggtggacccccagggccagcgcacc
atcggggtcatcaccaagctggacctgatggacgagggcacagatgcccgtgacgtgctg
gagaacaagctgctccccctgcgcagaggctacattggggtggtgaaccggagccagaag
gacattgatggcaagaaggacattaccgctgccttggctgctgaacgaaagttcttcctc
tcccatccatcttatcgccacttggctgaccgtatgggcacgccctacctgcagaaggtc
ctcaatcagcaactgacgaaccacatccgggacacactgccggggctgcggaacaagctg
cagagccagctgctgtccattgagaaggaggtggaggagtacaagaacttccgccctgat
gacccggctcgcaagaccaaggccctgctgcagatggtccagcagttcgccgtagacttt
gagaagcgcattgagggctcaggagatcagatcgacacctatgaactgtcagggggagcc
cgcattaaccgaatcttccacgagcgcttcccctttgagctggtcaagatggagtttgac
gagaaggaacttcgaagggagatcagctatgctatcaagaatatccatggcattaggacg
ggcctcttcacacctgacctcgcttttgaagccacagtgaaaaagcaggtgcagaagctc
aaagagcccagtatcaagtgtgtggatatggtagtcagtgagctcacagccaccatcaga
aagtgtagcgaaaagctccagcagtacccgcggctgcgggaggagatggagcgcatcgtg
accacccacatccgggagcgcgagggccgcaccaaggagcaggtcatgcttctcatcgat
atcgagctggcttacatgaacaccaaccatgaggacttcataggctttgccaatgctcag
cagaggagtaaccagatgaacaagaagaagacttcagggaaccaggatgagattctggtc
atccgcaagggctggctgactatcaataatattggcatcatgaaagggggctccaaggag
tactggtttgtgctgaccgctgagaatctgtcctggtacaaggatgatgaggagaaagag
aagaaatacatgctgtctgtggacaacctcaagctgcgggacgtggagaagggcttcatg
tcgagcaagcacatctttgccctctttaacacggaacagaggaatgtctataaggattat
cggcagctggagctggcctgtgagacacaggaggaggtggacagctggaaggcctccttc
ctgagggctggcgtataccctgagcgtgttggggacaaagagaaagccagtgagaccgag
gagaatggctccgacagcttcatgcattccatggacccacagctggaacggcaagtggag
accatccggaatcttgtggactcgtacatggccattgtcaacaagaccgtgcgggacctc
atgcccaaaaccatcatgcacctcatgattaacaataccaaggagttcatcttctcggag
ctgctggccaacctgtactcgtgtggggaccagaacacgctgatggaggagtcggcggag
caggcacagcggcgcgacgagatgctgcgcatgtaccacgctctgaaggaggcgctcagc
atcatcggcgacatcaatacgaccaccgtcagcacgcccatgcccccgcccgtggacgac
tcctggctgcaggtgcagagcgtaccggccggacgcaggtcgcccacgtccagccccacg
ccgcagcgccgagcccccgccgtgcccccagcccggcccgggtcgcggggccctgctcct
gggcctccgcctgctgggtccgccctggggggggcgccccccgtgccctccaggccgggg
gcttcccctgaccctttcggccctccccctcaggtgccctcgcgccccaaccgcgccccg
cccggggtccccagcaggaagggcccagcctcacctacgcgacctgcagccccccgacca
gctgaggctcccctcttagacttataa

DBGET integrated database retrieval system