KEGG   Macaca mulatta (rhesus monkey): 705680
Entry
705680            CDS       T01028                                 

Gene name
GNAQ
Definition
(RefSeq) guanine nucleotide-binding protein G(q) subunit alpha
  KO
K04634  guanine nucleotide-binding protein G(q) subunit alpha
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04015  Rap1 signaling pathway
mcc04020  Calcium signaling pathway
mcc04022  cGMP-PKG signaling pathway
mcc04062  Chemokine signaling pathway
mcc04071  Sphingolipid signaling pathway
mcc04261  Adrenergic signaling in cardiomyocytes
mcc04270  Vascular smooth muscle contraction
mcc04371  Apelin signaling pathway
mcc04540  Gap junction
mcc04611  Platelet activation
mcc04713  Circadian entrainment
mcc04720  Long-term potentiation
mcc04723  Retrograde endocannabinoid signaling
mcc04724  Glutamatergic synapse
mcc04725  Cholinergic synapse
mcc04726  Serotonergic synapse
mcc04728  Dopaminergic synapse
mcc04730  Long-term depression
mcc04750  Inflammatory mediator regulation of TRP channels
mcc04911  Insulin secretion
mcc04912  GnRH signaling pathway
mcc04915  Estrogen signaling pathway
mcc04916  Melanogenesis
mcc04918  Thyroid hormone synthesis
mcc04921  Oxytocin signaling pathway
mcc04922  Glucagon signaling pathway
mcc04924  Renin secretion
mcc04925  Aldosterone synthesis and secretion
mcc04927  Cortisol synthesis and secretion
mcc04928  Parathyroid hormone synthesis, secretion and action
mcc04929  GnRH secretion
mcc04934  Cushing syndrome
mcc04935  Growth hormone synthesis, secretion and action
mcc04961  Endocrine and other factor-regulated calcium reabsorption
mcc04970  Salivary secretion
mcc04971  Gastric acid secretion
mcc04972  Pancreatic secretion
mcc05010  Alzheimer disease
mcc05016  Huntington disease
mcc05017  Spinocerebellar ataxia
mcc05022  Pathways of neurodegeneration - multiple diseases
mcc05135  Yersinia infection
mcc05142  Chagas disease
mcc05143  African trypanosomiasis
mcc05146  Amoebiasis
mcc05163  Human cytomegalovirus infection
mcc05170  Human immunodeficiency virus 1 infection
mcc05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    705680 (GNAQ)
   04371 Apelin signaling pathway
    705680 (GNAQ)
   04020 Calcium signaling pathway
    705680 (GNAQ)
   04071 Sphingolipid signaling pathway
    705680 (GNAQ)
   04022 cGMP-PKG signaling pathway
    705680 (GNAQ)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    705680 (GNAQ)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    705680 (GNAQ)
   04062 Chemokine signaling pathway
    705680 (GNAQ)
  09152 Endocrine system
   04911 Insulin secretion
    705680 (GNAQ)
   04922 Glucagon signaling pathway
    705680 (GNAQ)
   04929 GnRH secretion
    705680 (GNAQ)
   04912 GnRH signaling pathway
    705680 (GNAQ)
   04915 Estrogen signaling pathway
    705680 (GNAQ)
   04921 Oxytocin signaling pathway
    705680 (GNAQ)
   04935 Growth hormone synthesis, secretion and action
    705680 (GNAQ)
   04918 Thyroid hormone synthesis
    705680 (GNAQ)
   04928 Parathyroid hormone synthesis, secretion and action
    705680 (GNAQ)
   04916 Melanogenesis
    705680 (GNAQ)
   04924 Renin secretion
    705680 (GNAQ)
   04925 Aldosterone synthesis and secretion
    705680 (GNAQ)
   04927 Cortisol synthesis and secretion
    705680 (GNAQ)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    705680 (GNAQ)
   04270 Vascular smooth muscle contraction
    705680 (GNAQ)
  09154 Digestive system
   04970 Salivary secretion
    705680 (GNAQ)
   04971 Gastric acid secretion
    705680 (GNAQ)
   04972 Pancreatic secretion
    705680 (GNAQ)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    705680 (GNAQ)
  09156 Nervous system
   04724 Glutamatergic synapse
    705680 (GNAQ)
   04725 Cholinergic synapse
    705680 (GNAQ)
   04728 Dopaminergic synapse
    705680 (GNAQ)
   04726 Serotonergic synapse
    705680 (GNAQ)
   04720 Long-term potentiation
    705680 (GNAQ)
   04730 Long-term depression
    705680 (GNAQ)
   04723 Retrograde endocannabinoid signaling
    705680 (GNAQ)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    705680 (GNAQ)
  09159 Environmental adaptation
   04713 Circadian entrainment
    705680 (GNAQ)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    705680 (GNAQ)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    705680 (GNAQ)
   05016 Huntington disease
    705680 (GNAQ)
   05017 Spinocerebellar ataxia
    705680 (GNAQ)
   05022 Pathways of neurodegeneration - multiple diseases
    705680 (GNAQ)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    705680 (GNAQ)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    705680 (GNAQ)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    705680 (GNAQ)
   05163 Human cytomegalovirus infection
    705680 (GNAQ)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    705680 (GNAQ)
   05142 Chagas disease
    705680 (GNAQ)
   05143 African trypanosomiasis
    705680 (GNAQ)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcc04147]
    705680 (GNAQ)
   04031 GTP-binding proteins [BR:mcc04031]
    705680 (GNAQ)
Exosome [BR:mcc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   705680 (GNAQ)
GTP-binding proteins [BR:mcc04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 3 (Gq/11) [OT]
    705680 (GNAQ)
SSDB
Motif
Pfam: G-alpha Arf Gtr1_RagA TniB AAA_29
Other DBs
NCBI-GeneID: 705680
NCBI-ProteinID: NP_001248524
UniProt: H9FT55
LinkDB
Position
15
AA seq 359 aa
MTLESIMACCLSEEAKEARRINDEIERQLRRDKRDARRELKLLLLGTGESGKSTFIKQMR
IIHGSGYSDEDKRGFTKLVYQNIFTAMQAMIRAMDTLKIPYKYEHNKAHAQLVREVDVEK
VSAFENPYVDAIKSLWNDPGIQECYDRRREYQLSDSTKYYLNDLDRVADPAYLPTQQDVL
RVRVPTTGIIEYPFDLQSVIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLV
ESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKIMYSHLVDYFPEYDGPQR
DAQAAREFILKMFVDLNPDSDKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYNLV
NT seq 1080 nt   +upstreamnt  +downstreamnt
atgactctggagtccatcatggcgtgctgcctgagcgaggaggccaaggaagcccggcgg
atcaacgacgagatcgagcggcagctccgcagggacaagcgggacgcccgccgggagctc
aagctgctgctgctcgggacaggagagagtggcaagagtacgtttatcaagcagatgaga
atcatccatgggtcaggatactctgatgaagataaaaggggcttcaccaagctggtgtat
cagaacatcttcacggccatgcaggccatgatcagagccatggacacactcaagatccca
tacaagtatgagcacaataaggctcatgcacaattagttcgagaagttgatgtggagaag
gtgtctgcttttgagaatccatatgtagatgcaataaagagtttatggaatgatcctgga
atccaggaatgctatgatagacgacgagaatatcaattatctgactctaccaaatactat
cttaatgacttggaccgcgtagctgaccctgcctacctgcctacgcaacaagatgtgctt
agagttcgagtccccaccacagggatcatcgaatacccctttgacttacaaagtgtcatt
ttcagaatggtcgatgtagggggccaaaggtcagagagaagaaaatggatacactgcttt
gaaaatgtcacctctatcatgtttctagtagcgcttagtgaatatgatcaagttctcgtg
gagtcagacaatgagaaccgaatggaggaaagcaaggctctgtttagaacaattatcaca
tatccctggttccagaattcctcggttattctgttcctaaacaagaaagatcttctagag
gagaaaatcatgtattcccatctagttgactacttcccagaatatgatggaccccagaga
gatgcccaggcagcccgagaattcattctgaagatgttcgtggacctgaacccagacagt
gacaaaattatctactcccacttcacatgcgcgacagacaccgagaacatccgctttgtc
tttgctgccgtcaaggacaccatcctccagttgaacctgaaggagtacaatctggtctaa

KEGG   Macaca mulatta (rhesus monkey): 721649
Entry
721649            CDS       T01028                                 

Gene name
GNA11
Definition
(RefSeq) guanine nucleotide-binding protein subunit alpha-11
  KO
K04635  guanine nucleotide-binding protein subunit alpha-11
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04020  Calcium signaling pathway
mcc04022  cGMP-PKG signaling pathway
mcc04270  Vascular smooth muscle contraction
mcc04540  Gap junction
mcc04725  Cholinergic synapse
mcc04730  Long-term depression
mcc04911  Insulin secretion
mcc04912  GnRH signaling pathway
mcc04925  Aldosterone synthesis and secretion
mcc04927  Cortisol synthesis and secretion
mcc04928  Parathyroid hormone synthesis, secretion and action
mcc04929  GnRH secretion
mcc04934  Cushing syndrome
mcc04935  Growth hormone synthesis, secretion and action
mcc05142  Chagas disease
mcc05146  Amoebiasis
mcc05163  Human cytomegalovirus infection
mcc05170  Human immunodeficiency virus 1 infection
mcc05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    721649 (GNA11)
   04022 cGMP-PKG signaling pathway
    721649 (GNA11)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    721649 (GNA11)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    721649 (GNA11)
   04929 GnRH secretion
    721649 (GNA11)
   04912 GnRH signaling pathway
    721649 (GNA11)
   04935 Growth hormone synthesis, secretion and action
    721649 (GNA11)
   04928 Parathyroid hormone synthesis, secretion and action
    721649 (GNA11)
   04925 Aldosterone synthesis and secretion
    721649 (GNA11)
   04927 Cortisol synthesis and secretion
    721649 (GNA11)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    721649 (GNA11)
  09156 Nervous system
   04725 Cholinergic synapse
    721649 (GNA11)
   04730 Long-term depression
    721649 (GNA11)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    721649 (GNA11)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    721649 (GNA11)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    721649 (GNA11)
   05163 Human cytomegalovirus infection
    721649 (GNA11)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    721649 (GNA11)
   05142 Chagas disease
    721649 (GNA11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcc04147]
    721649 (GNA11)
   04031 GTP-binding proteins [BR:mcc04031]
    721649 (GNA11)
Exosome [BR:mcc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   721649 (GNA11)
  Exosomal proteins of melanoma cells
   721649 (GNA11)
GTP-binding proteins [BR:mcc04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 3 (Gq/11) [OT]
    721649 (GNA11)
SSDB
Motif
Pfam: G-alpha Arf Gtr1_RagA AAA_29
Other DBs
NCBI-GeneID: 721649
NCBI-ProteinID: NP_001253785
Ensembl: ENSMMUG00000002961
UniProt: F7GZP9
LinkDB
Position
19
AA seq 359 aa
MTLESMMACCLSDEVKESKRINAEIEKQLRRDKRDARRELKLLLLGTGESGKSTFIKQMR
IIHGAGYSEEDKRSFTKLVYQNIFTAMQAMIRAMETLKILYKYEQNKANALLIREVDVEK
VTTFEHQYVSAIKTLWDDPGIQECYDRRREYQLSDSAKYYLTDVDRIATSGYLPTQQDVL
RVRVPTTGIIEYPFDLENIIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLV
ESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEDKILYSHLVDYFPEFDGPQR
DAQAAREFILKMFVDLNPDSDKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYNLV
NT seq 1080 nt   +upstreamnt  +downstreamnt
atgactctggagtccatgatggcgtgttgcctgagcgatgaggtgaaggagtccaagcgg
atcaacgccgagatcgagaagcagctgcggcgggacaagcgcgacgcccggcgcgagctc
aagctgctgctgctcggcacgggcgagagcgggaagagcaccttcatcaagcagatgcgc
atcatccatggcgccggctactcggaggaggacaagcgcagcttcaccaagctcgtctac
cagaacatcttcaccgccatgcaggccatgatccgggccatggagacgctcaagatcctc
tacaagtacgagcagaacaaggccaatgcgctcctgatccgggaggtggacgtggagaag
gtgaccaccttcgagcatcagtacgtcagcgccatcaagaccctgtgggacgaccccggc
atccaggagtgctacgaccgcaggcgcgagtaccagctctccgactctgccaagtactac
ctgaccgacgtggaccgcatcgcaacctcgggctacctgcccacccagcaggacgtgctg
cgggtccgcgtgcccaccaccggcatcatcgagtaccctttcgacctggagaacatcatc
ttcaggatggtggatgtgggcggccagcggtcggagcggaggaagtggatccactgcttt
gagaacgtgacatccatcatgtttctcgtcgccctcagcgaatacgaccaagtcctggtg
gagtcggacaatgagaaccggatggaggagagcaaagccctgttccggaccatcatcacc
tacccctggttccagaactcctccgtcatcctgttcctcaacaagaaggacctgttggag
gacaagatcctatactcgcacctggtggactacttccccgagttcgacgggccccagcgg
gacgctcaggcggcgcgggagttcatcctgaagatgttcgtggacctgaaccccgacagc
gacaagatcatctactcacacttcacgtgtgccaccgacacggagaacatccgcttcgtg
ttcgcggccgtgaaggataccatcctgcagctcaacctcaaggagtacaacctggtctga

DBGET integrated database retrieval system