KEGG   Macaca mulatta (rhesus monkey): 705713
Entry
705713            CDS       T01028                                 

Gene name
POLK
Definition
(RefSeq) DNA polymerase kappa isoform X1
  KO
K03511  DNA polymerase kappa [EC:2.7.7.7]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc03460  Fanconi anemia pathway
mcc05169  Epstein-Barr virus infection
mcc05200  Pathways in cancer
mcc05202  Transcriptional misregulation in cancer
mcc05210  Colorectal cancer
mcc05212  Pancreatic cancer
mcc05213  Endometrial cancer
mcc05214  Glioma
mcc05216  Thyroid cancer
mcc05217  Basal cell carcinoma
mcc05218  Melanoma
mcc05220  Chronic myeloid leukemia
mcc05222  Small cell lung cancer
mcc05223  Non-small cell lung cancer
mcc05224  Breast cancer
mcc05225  Hepatocellular carcinoma
mcc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    705713 (POLK)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    705713 (POLK)
   05202 Transcriptional misregulation in cancer
    705713 (POLK)
  09162 Cancer: specific types
   05210 Colorectal cancer
    705713 (POLK)
   05212 Pancreatic cancer
    705713 (POLK)
   05225 Hepatocellular carcinoma
    705713 (POLK)
   05226 Gastric cancer
    705713 (POLK)
   05214 Glioma
    705713 (POLK)
   05216 Thyroid cancer
    705713 (POLK)
   05220 Chronic myeloid leukemia
    705713 (POLK)
   05217 Basal cell carcinoma
    705713 (POLK)
   05218 Melanoma
    705713 (POLK)
   05213 Endometrial cancer
    705713 (POLK)
   05224 Breast cancer
    705713 (POLK)
   05222 Small cell lung cancer
    705713 (POLK)
   05223 Non-small cell lung cancer
    705713 (POLK)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    705713 (POLK)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mcc03400]
    705713 (POLK)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     705713 (POLK)
DNA repair and recombination proteins [BR:mcc03400]
 Eukaryotic type
  TLS (translesion DNA synthesis) factors
   Y-family DNA polymerases
    705713 (POLK)
SSDB
Motif
Pfam: IMS IMS_C IMS_HHH ATP-cone
Other DBs
NCBI-GeneID: 705713
NCBI-ProteinID: XP_001105220
Ensembl: ENSMMUG00000006144
LinkDB
Position
6
AA seq 870 aa
MDSIKEKCDSYKDDLLLRMGLNDNKAGMEGLDKEKINKIIMEATKGSRFYGNELKKEKQV
NQRIENMMQQKAQITSQQLRKAQLQVDRFAMELEQSRNLSNTIVHIDMDAFYAAVEMRDN
PELKDKPIAVGSMSMLSTSNYHARRFGVRAAMPGFIAKRLCPQLIIVPPNFDKYRAVSKE
VKEILADYDPNFMAMSLDEAYLNITKHLEERQNWPEDKRKYFIKMGNSVENDNPGKEVNK
LSDHERSISPLLFEESPSDLLPPGDPFQVNFEEQNSPQILQNSIVFGTSAEEVVKEIRFR
IEQKTTLTASAGIAPNTMLAKVCSDKNKPNGQYQILPNRQAVMDFIKDLPIRKVSGIGKV
TEKMLKALGIITCTELYQQRALLSLLFSETSWHYFLHISLGLGSTYLTRDGERKSMSVER
TFSEINKAEEQYSLCEELCSELARDLQKEGLKGRTVTIKLKNVNFEVKTRASTVSSVVST
AEEIFAIAKELLKTEIDADFPHPLRLRLMGVRISSFPNEEDRKHQQRSIIGFLQAGNQAL
SATGCILEKTDKDQFVKPLEMSHKKSFFDKKRSERKWSHQDTFKCETVNKQSFQTSQPFQ
VLKKKMSENLEIPENSDNCQIFTCPVCFRAQGCISLEAFNKHVDACLDGSSISENSKVFS
CSHVSATRVNKKENVPASSLCEKQDYEAHPKIKEVSSVDCVALVDTIDNSSKAESIDALS
NKHIKGECSNLPGKSFNIEHCHQNYSCTVSLENEDVGLLSRQESCQPYLCEVITGQALVC
PVCNVEQKTSDLTLFNVHVDVCLNKSFIQELRNDKVNPVNQPKESSRSTGSSSGVQKAVT
KTKRPGLMTKYSSKKIKPNNPKHTLDIFFK
NT seq 2613 nt   +upstreamnt  +downstreamnt
atggatagcataaaggagaaatgtgacagttacaaagatgatcttctgcttaggatggga
cttaatgataataaagcaggaatggaaggattagataaagagaaaattaacaaaattata
atggaagccacaaagggctccagattttatggaaatgaactcaagaaagaaaagcaggtc
aaccaacgaattgaaaatatgatgcaacaaaaagctcaaatcaccagccaacagctaaga
aaagcacaattacaggttgacagatttgcaatggaattagaacagagccgaaatttgagc
aataccatagtgcacattgacatggatgctttctatgcagctgtagaaatgagggacaat
ccagaattgaaggataaacctattgctgtaggatcaatgagtatgctgtctacttcaaat
taccatgcaaggaggtttggtgttcgtgcagccatgccaggatttattgctaagagactc
tgcccacaacttataatagtgcctccaaactttgacaaataccgagctgtgagtaaagag
gttaaggaaatacttgctgattatgatcccaattttatggccatgagtcttgatgaagcc
tacttgaatataacaaaacacttagaagaaagacaaaattggcctgaggataaaagaaag
tatttcatcaaaatgggaaactctgtagaaaatgataatccaggaaaggaagttaataaa
ctgagtgaccatgaacgatccatctctccactactttttgaagagagtccttctgatttg
ctgcccccaggagatcctttccaagtgaactttgaagaacaaaacagtcctcaaatactc
caaaactcaattgtttttggaacatcagccgaggaagtggtaaaggaaattcgtttcaga
atcgagcaaaaaacaacattgacagccagtgcaggcattgccccaaatacaatgttagca
aaagtatgcagtgataagaataaaccaaatggacaataccaaattcttcccaatagacaa
gctgtgatggacttcatcaaggatttacccattagaaaggtttctggaataggaaaagtt
acagagaaaatgttaaaggcccttggaattattacatgtacggaactttaccaacagagg
gcattgctttctctccttttctctgaaacatcttggcattatttccttcatatctccttg
ggtctaggttcaacatacctgacaagggatggagagaggaagagtatgagcgttgagagg
acattcagtgagataaataaagcggaagaacaatacagcctatgtgaagaactttgcagt
gaacttgctcgagatctacagaaagaaggacttaagggtagaactgttaccattaagttg
aagaatgtgaattttgaagtaaaaactcgtgcatctacagtttcatctgttgtttctact
gcagaagaaatatttgccattgctaaggaattgctaaaaacagaaattgatgctgatttt
ccgcatcccttgagattaagacttatgggtgttcggatatctagttttcccaatgaagaa
gacaggaaacaccaacaaaggagcattattggctttttacaggcgggaaaccaagccctg
tcagccactgggtgtatactagagaaaacagacaaagatcagtttgtaaaacctctagaa
atgtctcataagaagagtttctttgataaaaaacgatcagaaaggaaatggagtcaccaa
gatacatttaaatgtgaaactgtgaataaacaaagtttccagacatcacaaccattccaa
gttttaaagaagaagatgagtgagaatttggaaataccagagaattcagataactgtcag
atatttacctgtcctgtttgctttagggcacaagggtgcatcagtctggaagcctttaat
aaacatgtagatgcatgtcttgatggatcttcaatcagtgaaaactctaaagtgttctcg
tgttcacatgtttctgctaccagagttaacaagaaagaaaatgttcctgcttcttcactt
tgtgagaagcaagattatgaagcccatccaaaaattaaagaagtgtcttcagtagattgt
gtagctttagtagatactatagataactcatctaaagcagaaagcatagatgctttaagt
aataagcatatcaagggagaatgttctaatctcccaggcaagtcttttaatattgaacac
tgtcatcagaattattcttgcactgtttcgttggaaaacgaagatgttggattattaagc
agacaagaatcctgccagccttacttatgtgaagtgataacaggccaagctctagtttgt
cctgtttgtaatgtagaacaaaagacttcagatctaaccctgttcaatgtgcatgtggat
gtttgcttaaataaaagttttatccaagaattaagaaatgacaaagttaacccagttaat
caacccaaagaaagctccagaagtactggtagctcaagtggagtacagaaggctgtaaca
aaaacaaaaaggccaggattgatgacaaagtactcatcaaagaaaataaaaccaaacaat
cccaaacatacccttgatatattttttaagtaa

DBGET integrated database retrieval system