KEGG   Macaca mulatta (rhesus monkey): 705819
Entry
705819            CDS       T01028                                 

Gene name
IL6
Definition
(RefSeq) interleukin-6 precursor
  KO
K05405  interleukin 6
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc01521  EGFR tyrosine kinase inhibitor resistance
mcc01523  Antifolate resistance
mcc04060  Cytokine-cytokine receptor interaction
mcc04061  Viral protein interaction with cytokine and cytokine receptor
mcc04066  HIF-1 signaling pathway
mcc04068  FoxO signaling pathway
mcc04151  PI3K-Akt signaling pathway
mcc04218  Cellular senescence
mcc04620  Toll-like receptor signaling pathway
mcc04621  NOD-like receptor signaling pathway
mcc04623  Cytosolic DNA-sensing pathway
mcc04625  C-type lectin receptor signaling pathway
mcc04630  JAK-STAT signaling pathway
mcc04640  Hematopoietic cell lineage
mcc04657  IL-17 signaling pathway
mcc04659  Th17 cell differentiation
mcc04668  TNF signaling pathway
mcc04672  Intestinal immune network for IgA production
mcc04931  Insulin resistance
mcc04932  Non-alcoholic fatty liver disease
mcc04933  AGE-RAGE signaling pathway in diabetic complications
mcc05010  Alzheimer disease
mcc05020  Prion disease
mcc05022  Pathways of neurodegeneration - multiple diseases
mcc05132  Salmonella infection
mcc05133  Pertussis
mcc05134  Legionellosis
mcc05135  Yersinia infection
mcc05142  Chagas disease
mcc05143  African trypanosomiasis
mcc05144  Malaria
mcc05146  Amoebiasis
mcc05152  Tuberculosis
mcc05161  Hepatitis B
mcc05162  Measles
mcc05163  Human cytomegalovirus infection
mcc05164  Influenza A
mcc05166  Human T-cell leukemia virus 1 infection
mcc05167  Kaposi sarcoma-associated herpesvirus infection
mcc05168  Herpes simplex virus 1 infection
mcc05169  Epstein-Barr virus infection
mcc05171  Coronavirus disease - COVID-19
mcc05200  Pathways in cancer
mcc05202  Transcriptional misregulation in cancer
mcc05321  Inflammatory bowel disease
mcc05323  Rheumatoid arthritis
mcc05332  Graft-versus-host disease
mcc05410  Hypertrophic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    705819 (IL6)
   04668 TNF signaling pathway
    705819 (IL6)
   04066 HIF-1 signaling pathway
    705819 (IL6)
   04068 FoxO signaling pathway
    705819 (IL6)
   04151 PI3K-Akt signaling pathway
    705819 (IL6)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    705819 (IL6)
   04061 Viral protein interaction with cytokine and cytokine receptor
    705819 (IL6)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    705819 (IL6)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    705819 (IL6)
   04620 Toll-like receptor signaling pathway
    705819 (IL6)
   04621 NOD-like receptor signaling pathway
    705819 (IL6)
   04623 Cytosolic DNA-sensing pathway
    705819 (IL6)
   04625 C-type lectin receptor signaling pathway
    705819 (IL6)
   04659 Th17 cell differentiation
    705819 (IL6)
   04657 IL-17 signaling pathway
    705819 (IL6)
   04672 Intestinal immune network for IgA production
    705819 (IL6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    705819 (IL6)
   05202 Transcriptional misregulation in cancer
    705819 (IL6)
  09163 Immune disease
   05323 Rheumatoid arthritis
    705819 (IL6)
   05321 Inflammatory bowel disease
    705819 (IL6)
   05332 Graft-versus-host disease
    705819 (IL6)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    705819 (IL6)
   05020 Prion disease
    705819 (IL6)
   05022 Pathways of neurodegeneration - multiple diseases
    705819 (IL6)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    705819 (IL6)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    705819 (IL6)
   04931 Insulin resistance
    705819 (IL6)
   04933 AGE-RAGE signaling pathway in diabetic complications
    705819 (IL6)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    705819 (IL6)
   05135 Yersinia infection
    705819 (IL6)
   05133 Pertussis
    705819 (IL6)
   05134 Legionellosis
    705819 (IL6)
   05152 Tuberculosis
    705819 (IL6)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    705819 (IL6)
   05161 Hepatitis B
    705819 (IL6)
   05171 Coronavirus disease - COVID-19
    705819 (IL6)
   05164 Influenza A
    705819 (IL6)
   05162 Measles
    705819 (IL6)
   05168 Herpes simplex virus 1 infection
    705819 (IL6)
   05163 Human cytomegalovirus infection
    705819 (IL6)
   05167 Kaposi sarcoma-associated herpesvirus infection
    705819 (IL6)
   05169 Epstein-Barr virus infection
    705819 (IL6)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    705819 (IL6)
   05144 Malaria
    705819 (IL6)
   05142 Chagas disease
    705819 (IL6)
   05143 African trypanosomiasis
    705819 (IL6)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    705819 (IL6)
   01523 Antifolate resistance
    705819 (IL6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcc04052]
    705819 (IL6)
Cytokines and growth factors [BR:mcc04052]
 Cytokines
  Interleukins
   705819 (IL6)
SSDB
Motif
Pfam: IL6 IL11 IL23 GCSF Phage_int_SAM_1
Other DBs
NCBI-GeneID: 705819
NCBI-ProteinID: NP_001036198
Ensembl: ENSMMUG00000019983
UniProt: A0A1D5QRZ4
LinkDB
Position
3
AA seq 212 aa
MNSVSTSAFGPVAFSLGLLLVLPAAFPAPVLPGEDSKDVAAPHSQPLTSSERIDKHIRYI
LDGISALRKETCNRSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEDTCLVKIITGLL
EFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPEPTTNASLLTKLQ
AQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
NT seq 639 nt   +upstreamnt  +downstreamnt
atgaactccgtctccacaagcgccttcggtccagttgccttctccctggggctgctcctg
gtgttgcctgctgccttccccgccccagtactcccaggagaagattccaaagatgtagcc
gccccacacagccagccactgacctcttcagaacgaattgacaaacacattcggtacatc
ctcgacggcatctcagccctgagaaaggagacatgtaacaggagtaacatgtgtgaaagc
agcaaagaggcactggcagaaaacaacctgaaccttccaaagatggctgaaaaagatgga
tgcttccaatctggattcaatgaggacacttgcctggtgaaaatcatcactggtcttttg
gagtttgaggtatacctagagtacctccagaacaggtttgagagtagtgaggagcaagcc
agagctgtgcaaatgagtacaaaagtcctgatccagttcctgcagaaaaaggcaaagaat
ctagatgcaataaccacccctgaaccaaccacaaatgccagcctgctgacgaagctgcag
gcacagaaccagtggctgcaggacatgacgacgcatctcatcctgcgcagctttaaggag
ttcctgcagtccagcctgagggctcttcggcaaatgtaa

DBGET integrated database retrieval system