KEGG   Macaca mulatta (rhesus monkey): 705853
Entry
705853            CDS       T01028                                 

Gene name
PLAU
Definition
(RefSeq) urokinase-type plasminogen activator isoform X1
  KO
K01348  urokinase plasminogen activator [EC:3.4.21.73]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04064  NF-kappa B signaling pathway
mcc04610  Complement and coagulation cascades
mcc05202  Transcriptional misregulation in cancer
mcc05205  Proteoglycans in cancer
mcc05206  MicroRNAs in cancer
mcc05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    705853 (PLAU)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    705853 (PLAU)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    705853 (PLAU)
   05206 MicroRNAs in cancer
    705853 (PLAU)
   05205 Proteoglycans in cancer
    705853 (PLAU)
  09162 Cancer: specific types
   05215 Prostate cancer
    705853 (PLAU)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mcc01002]
    705853 (PLAU)
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:mcc00536]
    705853 (PLAU)
Enzymes [BR:mcc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.73  u-plasminogen activator
     705853 (PLAU)
Peptidases and inhibitors [BR:mcc01002]
 Serine peptidases
  Family S1: chymotrypsin family
   705853 (PLAU)
Glycosaminoglycan binding proteins [BR:mcc00536]
 Heparan sulfate / Heparin
  Coagulation and fibrinolysis
   705853 (PLAU)
SSDB
Motif
Pfam: Trypsin Kringle DUF316
Other DBs
NCBI-GeneID: 705853
NCBI-ProteinID: XP_015002761
Ensembl: ENSMMUG00000009906
UniProt: F6YDV7
LinkDB
Position
9
AA seq 430 aa
MRALLAHLLLCVLVVSDSKGSRELQVPSDCGCLNGGTCMSNKYFSSIHWCNCPKKFGGQH
CEIDKSKTCYEGNGHFYRGKASTDTMGRSCLAWNSATVLQQTYHAHRSDALQLGLGKHNY
CRNPDNRRRPWCYVQVGLKQLVQECMVQNCADGKKPSSPPEELQFQCGQRTLRPRFKIVG
GEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVVSATHCFINYPKKEDYIVYLGR
SRLNSNTQGEMKFEVENLILHEDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICLP
STYNDPPFGTSCEITGFGKENSTDYLYPERLKMTVVKLVSHQKCQQPHYYGSEVTTKMLC
AADPQWETDSCQGDSGGPLVCSIQGHMTLTGIVSWGRGCALKDKPGVYTRVSRFLPWIHS
HTREENGLAL
NT seq 1293 nt   +upstreamnt  +downstreamnt
atgagagccctgctggcacacctgcttctctgcgtcctggtcgtgagcgactccaaaggc
agccgtgaacttcaggttccatcagactgtggctgtctaaatggaggaacatgtatgtcc
aacaagtacttctccagcattcactggtgcaactgcccaaagaagttcggagggcagcac
tgtgagatagataagtcaaaaacctgctatgaggggaatggtcacttttaccgaggaaag
gccagcactgacaccatgggccggtcctgcctggcctggaactctgccaccgtccttcag
caaacataccatgcccacagatctgatgctcttcagctgggcctggggaagcacaattac
tgcaggaacccagacaaccggaggcgaccctggtgctatgtgcaggtcggcctaaagcag
cttgtccaagagtgcatggtgcaaaactgtgcagatggaaaaaagccctcctctcctcca
gaagaattacagtttcagtgtggccaaaggactctgaggccccgctttaagattgttggg
ggagaattcaccaccatcgagaaccagccctggtttgcagccatctacaggaggcaccgg
ggcggctctgtcacctacgtgtgtggaggcagcctcatcagcccttgctgggtggtcagc
gccacacactgcttcattaattacccaaagaaggaggactacatcgtctacctgggtcgc
tcaaggcttaactccaacacgcaaggggagatgaagtttgaggtggaaaacctcatccta
catgaggactacagcgctgacacgcttgctcaccacaacgacattgccttgctgaagatc
cgttctaaggagggcaggtgtgcgcagccatcccggactatacagaccatctgcctgccc
tcgacgtataacgatcccccttttggcacaagctgtgagatcactggctttggaaaagag
aattctaccgactatctctatccggagcggctgaaaatgactgttgtgaagctggtttcc
caccagaagtgtcagcagccccactactacggctctgaagtcaccaccaaaatgctgtgt
gctgctgacccacagtgggaaacagattcctgccagggagactcagggggaccccttgtc
tgttccatccaaggccacatgactttgactggaattgtgagctggggccgtggatgtgcc
ctaaaggacaagccaggcgtctacacgagagtctcacgcttcttgccctggattcacagt
cacaccagggaagagaatggcctagccctctga

DBGET integrated database retrieval system