KEGG   Macaca mulatta (rhesus monkey): 705970
Entry
705970            CDS       T01028                                 

Gene name
FGF1
Definition
(RefSeq) fibroblast growth factor 1
  KO
K18496  fibroblast growth factor 1
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04010  MAPK signaling pathway
mcc04014  Ras signaling pathway
mcc04015  Rap1 signaling pathway
mcc04151  PI3K-Akt signaling pathway
mcc04390  Hippo signaling pathway
mcc04810  Regulation of actin cytoskeleton
mcc05200  Pathways in cancer
mcc05218  Melanoma
mcc05224  Breast cancer
mcc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    705970 (FGF1)
   04014 Ras signaling pathway
    705970 (FGF1)
   04015 Rap1 signaling pathway
    705970 (FGF1)
   04390 Hippo signaling pathway
    705970 (FGF1)
   04151 PI3K-Akt signaling pathway
    705970 (FGF1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    705970 (FGF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    705970 (FGF1)
  09162 Cancer: specific types
   05226 Gastric cancer
    705970 (FGF1)
   05218 Melanoma
    705970 (FGF1)
   05224 Breast cancer
    705970 (FGF1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcc04052]
    705970 (FGF1)
   00536 Glycosaminoglycan binding proteins [BR:mcc00536]
    705970 (FGF1)
Cytokines and growth factors [BR:mcc04052]
 Growth factors
  Growth factors (RTK binding)
   705970 (FGF1)
Glycosaminoglycan binding proteins [BR:mcc00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   705970 (FGF1)
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 705970
NCBI-ProteinID: NP_001252958
UniProt: F7E243 A0A5F7ZF96
LinkDB
Position
6
AA seq 155 aa
MAEGEITTFTALTEKFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQ
LSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYTSKKHAEK
NWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
NT seq 468 nt   +upstreamnt  +downstreamnt
atggctgaaggggaaatcaccacgttcacagccctgaccgagaagtttaatctgcctcca
gggaattacaagaagcccaaactgctctactgtagcaatgggggccacttcttgaggatc
cttccggatggcacagtggatgggacaagggacaggagcgaccagcacattcagctgcag
ctcagtgcggaaagcgtgggggaggtgtatataaagagtaccgagactggccagtacttg
gccatggacaccgacgggcttttatacggctcacagacaccaaatgaggaatgtttgttc
ctggaaaggctggaggagaaccattacaacacctatacatccaagaagcacgcagagaag
aattggtttgttggcctcaagaagaatggaagctgcaaacgtggtcctcggactcactat
ggccagaaagcaatcttgtttcttcccctgccagtctcttctgattaa

DBGET integrated database retrieval system