KEGG   Macaca mulatta (rhesus monkey): 706152Help
Entry
706152            CDS       T01028                                 

Gene name
GYS2
Definition
(RefSeq) glycogen synthase 2
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc00500  Starch and sucrose metabolism
mcc01100  Metabolic pathways
mcc04151  PI3K-Akt signaling pathway
mcc04152  AMPK signaling pathway
mcc04910  Insulin signaling pathway
mcc04922  Glucagon signaling pathway
mcc04931  Insulin resistance
Module
mcc_M00854  Glycogen biosynthesis, glucose-1P => glycogen/starch
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    706152 (GYS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    706152 (GYS2)
   04152 AMPK signaling pathway
    706152 (GYS2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    706152 (GYS2)
   04922 Glucagon signaling pathway
    706152 (GYS2)
 09160 Human Diseases
  09167 Endocrine and metabolic diseases
   04931 Insulin resistance
    706152 (GYS2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:mcc01003]
    706152 (GYS2)
Enzymes [BR:mcc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     706152 (GYS2)
Glycosyltransferases [BR:mcc01003]
 Polysaccharide
  Storage polysaccharide
   706152 (GYS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glycos_transf_1 Glyco_trans_1_4 Glyco_transf_4
Motif
Other DBs
NCBI-GeneID: 706152
NCBI-ProteinID: XP_001098578
Ensembl: ENSMMUG00000016171
UniProt: F7FTD2
LinkDB All DBs
Position
11
AA seq 703 aa AA seqDB search
MLRGRSLSVTSLSGLPRWEVKELPVEELLLFEVAWEVTNKVGGIYTVIQTKAKTTADEWG
DNYFLIGPYFEHNMKTQVEQCEPVNDAVRRAVDAMNKHGCQVHFGRWLIEGSPYVVLFDI
GFSAWNLDRWKGDLWEACSVGIPYHDREANDMLIFGSLTAWFLKEVTDHADDKHVVAQFH
EWQAGIGLILSRARKLPIATIFTTHATLLGRYLCAANIDFYNHLDKFNIDKEAGERQIYH
RYCMERASVHCAHVFTTVSEITAIEAEHMLKRKPDVVTPNGLNVKKFSAVHEFQNLHAMY
KARIQDFVRGHFYGHLDFDLEKTLFLFIAGRYEFSNKGADIFLESLSRLNFLLRMHKSDV
TVVVFFIMPAKTNNFNVETLKGQAVRKQLWDIAHSVKEKFGKKLYDALLRGEIPDMNNIL
DRDDLTIMKRAIFSTQRQSLPPVTTHNMIDDSTDPILSTIRRIGLFNNRTDRVKVILHPE
FLSSTSPLLPMDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMQE
HVADPTAYGIYIVDRRFRSPDDSCNQLTQFLYGFCKQSRRQRIIQRNRTERLSDLLDWRY
LGRYYQHARHLTLSRAFPDKFHVELTSPPMTEGFKYPRPSSVPPSPSGSQASSPQSSDVE
DEVEDERYDEEKEAERDRLNIKSPFALSHVPRGKKKLHGEYKN
NT seq 2112 nt NT seq  +upstreamnt  +downstreamnt
atgcttcgaggccgatccctgtctgtaacatccctgagtgggctgccccggtgggaagtc
aaagaacttcctgtggaggagttactgctctttgaagttgcttgggaggtgaccaataaa
gttggaggcatctatactgtgattcagacaaaggccaaaacaacagcagatgaatgggga
gacaactattttctgataggtccatattttgagcataatatgaagactcaggtggaacaa
tgtgaacctgtaaatgatgctgtcagaagagcagtggatgcaatgaataagcatggctgc
caggtgcattttggaagatggctgatagaaggaagtccttatgtggtactttttgacata
ggcttttcagcttggaatctggataggtggaagggtgacctctgggaagcatgcagtgtc
ggcattccttatcatgaccgagaagccaatgatatgctgatatttggatctttaactgcc
tggttcttaaaagaggtgacagatcacgcagatgataaacatgtcgttgcccaattccat
gaatggcaggctggaattggactgatcctttctcgagccaggaaacttcctattgccaca
atatttacaacccacgctacactactcgggaggtatctctgtgcagcaaatattgatttc
tacaaccatcttgataagtttaacatagacaaagaggctggggaaaggcagatttaccac
cggtactgcatggagcgagcctccgttcattgcgctcatgtgttcaccacggtttctgaa
ataacagcaatagaggccgaacacatgctgaagagaaagcctgatgtagttactccaaat
ggcttgaatgttaagaaattttcagcagtgcatgagtttcaaaatctacatgccatgtac
aaggccagaatccaagattttgttcgaggtcatttctatggtcatctggactttgatctt
gaaaagactttgttccttttcattgctgggagatatgagttttcaaacaaaggagctgac
atcttcctagaatccttatccaggctaaatttcctgctgaggatgcataaaagtgacgtc
acagtggtggtgtttttcattatgcctgccaagacaaataatttcaacgtggaaaccctg
aaaggacaagcagtgcgaaaacaactgtgggacattgcacattctgtgaaggaaaagttt
ggaaaaaaactctatgatgcattattaagaggagaaattcctgacatgaacaatatttta
gatcgagatgatctaacaattatgaaaagagccatcttttcaactcagcgacagtcattg
cccccagtgaccacgcacaacatgattgatgactccaccgaccccatcctcagcaccatt
agacggatcggacttttcaacaaccgcacagacagagtcaaggtgattttgcacccggaa
tttctatcctccaccagtcccctactacccatggactatgaagagttcgtcagaggttgt
caccttggagtatttccatcatactatgaaccctggggttatactccagctgaatgcaca
gtgatgggtatccccagtgtgaccacgaatctctccgggtttggctgtttcatgcaggag
catgtggctgatcctactgcttacggtatttacatcgttgacaggcggttccgttctcca
gatgattcttgcaatcagctgactcagtttctttatggattttgcaaacagtcacgccgc
caaaggattatccagaggaacagaactgagaggctctcagatcttctggattggagatac
ttaggcagatattaccagcatgccagacacctgacattaagcagagcttttccagataaa
ttccatgtggaactaacatcaccaccaatgacagaaggatttaaatatcccaggccttcc
tcagtaccaccttctccttcagggtctcaggcctccagtcctcagagcagtgatgtggaa
gacgaagtggaggatgagagatacgatgaggaaaaggaggctgaaagggatcggttaaat
atcaagtcaccatttgcactgagccacgttcctcgtgggaagaaaaagctgcatggtgaa
tataagaactga

DBGET integrated database retrieval system