KEGG   Macaca mulatta (rhesus monkey): 706198
Entry
706198            CDS       T01028                                 

Gene name
NR3C1
Definition
(RefSeq) glucocorticoid receptor isoform X1
  KO
K05771  glucocorticoid receptor
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    706198 (NR3C1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mcc03000]
    706198 (NR3C1)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:mcc03310]
    706198 (NR3C1)
Transcription factors [BR:mcc03000]
 Eukaryotic type
  Zinc finger
   Cys4 estrogen receptor-like
    706198 (NR3C1)
Nuclear receptors [BR:mcc03310]
 3. Estrogen like
  3C. 3-Ketosteroid receptor
   706198 (NR3C1)
SSDB
Motif
Pfam: GCR Hormone_recep zf-C4 SCA7
Other DBs
NCBI-GeneID: 706198
NCBI-ProteinID: XP_014996598
Ensembl: ENSMMUG00000000421
LinkDB
Position
6
AA seq 778 aa
MDSKESLTPSREENPSSVLAQERGNVMDFYKTLRGGATVKVSASSPSLAVASQSDSKQRR
LLVDFPKGSVSNAQQPDLSKAVSLSMGLYMGETETKVMGNDLGFPQQGQISLSSGETDLK
LLEESIANLNRSTSVPENPKSSASTAVSAAPTKKEFPKTHSDGSSEQQNLKGHTGTNGGN
VKLYTADQSTFDILQDLEFSSGSPGKETNESPWRSDLLIDENCLLSPLAGEDDSFLLEGN
SNEDCKPLILPDTKPKIKDNGDLVLSSPNNATLPQVKTEKEDFIELCTPGVIKQEKLGTV
YCQASFPGANIIGNKMSAISVHGVSTSGGQMYHYDMNTASLSQQQDQKPIFNVIPPIPVG
SENWNRCQGSGDDNLTSLGTLNFPGRTVFSNGYSSPSMRPDVSSPPSSSSTATTGPPPKL
CLVCSDEASGCHYGVLTCGSCKVFFKRAVEGRQHNYLCAGRNDCIIDKIRRKNCPACRYR
KCLQAGMNLEARKTKKKIKGIQQATTGVSQETSENPANKTIVPATLPQLTPTLVSLLEVI
EPEVLYAGYDSSVPDSTWRIMTTLNMLGGRQVIAAVKWAKAIPGFRNLHLDDQMTLLQYS
WMFLMAFALGWRSYRQSSANLLCFAPDLIINEQRMTLPCMYDQCKHMLYVSSELHRLQVS
YEEYLCMKTLLLLSSVPKDGLKSQELFDEIRMTYIKELGKAIVKREGNSSQNWQRFYQLT
KLLDSMHEVVENLLNYCFQTFLDKTMSIEFPEMLAEIITNQIPKYSNGNIKKLLFHQK
NT seq 2337 nt   +upstreamnt  +downstreamnt
atggactccaaagaatcattaactcccagtagagaagaaaaccccagcagtgtgcttgct
caggagaggggaaatgtgatggacttctataaaaccctaaggggaggagctactgtgaag
gtttctgcatcttcaccctcactggctgtcgcttctcagtcagactccaagcagcgaaga
cttttggttgattttccaaaaggctcagtaagcaatgcgcagcagccagatctctccaaa
gcagtttcactctcaatgggactgtatatgggagagacagaaacaaaagtgatgggaaat
gacctgggattcccacagcagggccaaatcagcctttcctcgggggaaacagacttaaag
cttttggaagaaagcattgcaaacctcaataggtcgaccagtgttccagagaaccccaag
agttcagcatccactgctgtgtctgctgcccccacaaagaaggagtttccaaaaactcac
tctgatggatcttcagaacagcaaaatttgaagggccatactggcaccaacggcggcaat
gtgaaattgtataccgcagaccaaagcacctttgacattttgcaggatttggagttttct
tctgggtccccaggtaaagagacgaatgagagtccttggagatcagacctgttgatagat
gaaaactgtttgctttctcctctggcgggagaagacgattcattccttttggaaggaaat
tcgaatgaggactgtaagcctctcattttaccggacactaaacccaaaattaaggataat
ggagatctggttttgtcaagccccaataatgcaacactgccccaagtgaaaacagaaaaa
gaagatttcatcgaactctgcacccctggggtaattaagcaagagaaactgggcacagtt
tactgtcaggcaagctttcctggagcaaatataattggtaataaaatgtctgccatttct
gttcatggtgtgagtacctctggaggacagatgtaccactatgacatgaatacagcatcc
ctttctcaacagcaggatcagaagcctatttttaatgtcattccaccaattcccgttggt
tctgaaaattggaataggtgccaaggttctggagacgacaacttgacttccttggggact
ctgaacttccctggtcgaacagttttttctaatggctattcaagccccagcatgagacca
gatgtaagctctcctccatccagctcctcaacagcaacaacaggaccacctccgaaactc
tgcctggtgtgctctgatgaagcatcaggatgtcattatggagtcttaacttgtggaagc
tgtaaagttttcttcaaaagagcagtggaaggtagacagcacaattacctatgtgctgga
aggaatgattgcatcatcgataaaattcgaagaaaaaactgcccagcatgccgctatcga
aaatgtcttcaggctggaatgaacctggaagctcgaaaaacaaagaaaaaaataaaagga
attcagcaggccactacaggagtctcacaagaaacctctgaaaatcctgctaacaaaaca
atagttcctgcaacgttaccacaactcacccctaccctggtgtcactgttggaggttatt
gaacctgaagtgttatatgcaggatatgatagctctgttccagactcaacttggaggatc
atgaccacgctcaacatgttaggagggcggcaagtgattgcagcagtgaaatgggcaaaa
gcgataccaggtttcaggaacttacacctggatgaccaaatgaccctactgcaatactcc
tggatgtttcttatggcatttgccctggggtggagatcatatagacaatcaagtgcaaac
ctgctgtgttttgctcctgatctgattattaatgagcagagaatgactctaccctgcatg
tacgaccaatgtaaacacatgctgtatgtttcctctgagttacacaggcttcaggtatct
tatgaagaatatctctgtatgaaaaccttactgcttctctcttcagttcctaaagacggt
ctgaagagccaagagctatttgatgaaattagaatgacctacatcaaagagctaggaaaa
gccattgtcaagagggaaggaaactccagccagaactggcagcggttttatcaactgaca
aaactcttggattctatgcatgaagtggttgaaaatcttcttaactattgcttccaaaca
tttttggataagaccatgagtattgaattcccagagatgttagctgaaatcatcaccaat
cagataccaaaatattcaaatggaaatatcaaaaaacttctgtttcatcaaaagtga

DBGET integrated database retrieval system