KEGG   Macaca mulatta (rhesus monkey): 706455
Entry
706455            CDS       T01028                                 

Gene name
RHOA
Definition
(RefSeq) transforming protein RhoA
  KO
K04513  Ras homolog gene family, member A
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04014  Ras signaling pathway
mcc04015  Rap1 signaling pathway
mcc04022  cGMP-PKG signaling pathway
mcc04024  cAMP signaling pathway
mcc04062  Chemokine signaling pathway
mcc04071  Sphingolipid signaling pathway
mcc04072  Phospholipase D signaling pathway
mcc04144  Endocytosis
mcc04150  mTOR signaling pathway
mcc04270  Vascular smooth muscle contraction
mcc04310  Wnt signaling pathway
mcc04350  TGF-beta signaling pathway
mcc04360  Axon guidance
mcc04510  Focal adhesion
mcc04520  Adherens junction
mcc04530  Tight junction
mcc04611  Platelet activation
mcc04621  NOD-like receptor signaling pathway
mcc04625  C-type lectin receptor signaling pathway
mcc04660  T cell receptor signaling pathway
mcc04670  Leukocyte transendothelial migration
mcc04722  Neurotrophin signaling pathway
mcc04810  Regulation of actin cytoskeleton
mcc04921  Oxytocin signaling pathway
mcc04928  Parathyroid hormone synthesis, secretion and action
mcc04972  Pancreatic secretion
mcc05100  Bacterial invasion of epithelial cells
mcc05132  Salmonella infection
mcc05133  Pertussis
mcc05135  Yersinia infection
mcc05152  Tuberculosis
mcc05163  Human cytomegalovirus infection
mcc05200  Pathways in cancer
mcc05203  Viral carcinogenesis
mcc05205  Proteoglycans in cancer
mcc05206  MicroRNAs in cancer
mcc05210  Colorectal cancer
mcc05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    706455 (RHOA)
   04015 Rap1 signaling pathway
    706455 (RHOA)
   04310 Wnt signaling pathway
    706455 (RHOA)
   04350 TGF-beta signaling pathway
    706455 (RHOA)
   04072 Phospholipase D signaling pathway
    706455 (RHOA)
   04071 Sphingolipid signaling pathway
    706455 (RHOA)
   04024 cAMP signaling pathway
    706455 (RHOA)
   04022 cGMP-PKG signaling pathway
    706455 (RHOA)
   04150 mTOR signaling pathway
    706455 (RHOA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    706455 (RHOA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    706455 (RHOA)
   04520 Adherens junction
    706455 (RHOA)
   04530 Tight junction
    706455 (RHOA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    706455 (RHOA)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    706455 (RHOA)
   04621 NOD-like receptor signaling pathway
    706455 (RHOA)
   04625 C-type lectin receptor signaling pathway
    706455 (RHOA)
   04660 T cell receptor signaling pathway
    706455 (RHOA)
   04670 Leukocyte transendothelial migration
    706455 (RHOA)
   04062 Chemokine signaling pathway
    706455 (RHOA)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    706455 (RHOA)
   04928 Parathyroid hormone synthesis, secretion and action
    706455 (RHOA)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    706455 (RHOA)
  09154 Digestive system
   04972 Pancreatic secretion
    706455 (RHOA)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    706455 (RHOA)
  09158 Development and regeneration
   04360 Axon guidance
    706455 (RHOA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    706455 (RHOA)
   05206 MicroRNAs in cancer
    706455 (RHOA)
   05205 Proteoglycans in cancer
    706455 (RHOA)
   05203 Viral carcinogenesis
    706455 (RHOA)
  09162 Cancer: specific types
   05210 Colorectal cancer
    706455 (RHOA)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    706455 (RHOA)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    706455 (RHOA)
   05135 Yersinia infection
    706455 (RHOA)
   05133 Pertussis
    706455 (RHOA)
   05152 Tuberculosis
    706455 (RHOA)
   05100 Bacterial invasion of epithelial cells
    706455 (RHOA)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    706455 (RHOA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mcc04131]
    706455 (RHOA)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcc04147]
    706455 (RHOA)
   04031 GTP-binding proteins [BR:mcc04031]
    706455 (RHOA)
Membrane trafficking [BR:mcc04131]
 Endocytosis
  Lipid raft mediated endocytosis
   RhoA-dependent endocytosis
    706455 (RHOA)
Exosome [BR:mcc04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   706455 (RHOA)
  Exosomal proteins of other body fluids (saliva and urine)
   706455 (RHOA)
  Exosomal proteins of colorectal cancer cells
   706455 (RHOA)
  Exosomal proteins of bladder cancer cells
   706455 (RHOA)
GTP-binding proteins [BR:mcc04031]
 Small (monomeric) G-proteins
  Rho Family
   RhoA/B/C [OT]
    706455 (RHOA)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU SRPRB Gtr1_RagA
Other DBs
NCBI-GeneID: 706455
NCBI-ProteinID: XP_014986395
Ensembl: ENSMMUG00000047476
UniProt: G7MIM5 A0A5S6R6M9
LinkDB
Position
2
AA seq 193 aa
MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT
AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD
LRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ
ARRGKKKSGCLVL
NT seq 582 nt   +upstreamnt  +downstreamnt
atggctgccatccggaagaaactagtgattgttggtgacggagcctgtggaaagacatgc
ttgctcatagtcttcagcaaggaccagttcccagaggtgtatgtgcccacagtgtttgag
aactatgtggcagatatcgaggtggatggaaaacaggtagagttggctttgtgggacaca
gctgggcaggaagattatgatcgcctgaggcccctctcctacccagataccgatgttata
ctgatgtgtttttccatcgacagccctgatagtttagaaaacatcccagaaaagtggacc
ccggaagtcaagcatttctgtcccaacgtgcccatcatcctggttgggaataagaaggat
cttcggaatgatgagcacacaaggcgggagctagccaagatgaagcaggagccggtgaaa
cctgaagaaggcagagatatggcaaacaggattggtgcttttgggtacatggagtgttca
gcaaagaccaaagatggagtgagagaggtttttgaaatggctacgagagctgctctgcaa
gctagacgtgggaagaaaaaatctgggtgccttgtcttgtga

DBGET integrated database retrieval system