Macaca mulatta (rhesus monkey): 706455 Help Entry 706455            CDS       T01028                                  Gene name RHOA Definition (RefSeq) transforming protein RhoA   KO K04513   Ras homolog gene family, member A Organism mcc  Macaca mulatta (rhesus monkey) Pathway mcc04014   Ras signaling pathway mcc04015   Rap1 signaling pathway mcc04022   cGMP-PKG signaling pathway mcc04024   cAMP signaling pathway mcc04062   Chemokine signaling pathway mcc04071   Sphingolipid signaling pathway mcc04072   Phospholipase D signaling pathway mcc04144   Endocytosis mcc04150   mTOR signaling pathway mcc04270   Vascular smooth muscle contraction mcc04310   Wnt signaling pathway mcc04350   TGF-beta signaling pathway mcc04360   Axon guidance mcc04510   Focal adhesion mcc04520   Adherens junction mcc04530   Tight junction mcc04611   Platelet activation mcc04621   NOD-like receptor signaling pathway mcc04625   C-type lectin receptor signaling pathway mcc04660   T cell receptor signaling pathway mcc04670   Leukocyte transendothelial migration mcc04722   Neurotrophin signaling pathway mcc04810   Regulation of actin cytoskeleton mcc04921   Oxytocin signaling pathway mcc04928   Parathyroid hormone synthesis, secretion and action mcc04972   Pancreatic secretion mcc05100   Bacterial invasion of epithelial cells mcc05132   Salmonella infection mcc05133   Pertussis mcc05135   Yersinia infection mcc05152   Tuberculosis mcc05163   Human cytomegalovirus infection mcc05200   Pathways in cancer mcc05203   Viral carcinogenesis mcc05205   Proteoglycans in cancer mcc05206   MicroRNAs in cancer mcc05210   Colorectal cancer mcc05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:mcc00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     706455 (RHOA)    04015 Rap1 signaling pathway     706455 (RHOA)    04310 Wnt signaling pathway     706455 (RHOA)    04350 TGF-beta signaling pathway     706455 (RHOA)    04072 Phospholipase D signaling pathway     706455 (RHOA)    04071 Sphingolipid signaling pathway     706455 (RHOA)    04024 cAMP signaling pathway     706455 (RHOA)    04022 cGMP-PKG signaling pathway     706455 (RHOA)    04150 mTOR signaling pathway     706455 (RHOA)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     706455 (RHOA)   09144 Cellular community - eukaryotes    04510 Focal adhesion     706455 (RHOA)    04520 Adherens junction     706455 (RHOA)    04530 Tight junction     706455 (RHOA)   09142 Cell motility    04810 Regulation of actin cytoskeleton     706455 (RHOA)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     706455 (RHOA)    04621 NOD-like receptor signaling pathway     706455 (RHOA)    04625 C-type lectin receptor signaling pathway     706455 (RHOA)    04660 T cell receptor signaling pathway     706455 (RHOA)    04670 Leukocyte transendothelial migration     706455 (RHOA)    04062 Chemokine signaling pathway     706455 (RHOA)   09152 Endocrine system    04921 Oxytocin signaling pathway     706455 (RHOA)    04928 Parathyroid hormone synthesis, secretion and action     706455 (RHOA)   09153 Circulatory system    04270 Vascular smooth muscle contraction     706455 (RHOA)   09154 Digestive system    04972 Pancreatic secretion     706455 (RHOA)   09156 Nervous system    04722 Neurotrophin signaling pathway     706455 (RHOA)   09158 Development and regeneration    04360 Axon guidance     706455 (RHOA)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     706455 (RHOA)    05206 MicroRNAs in cancer     706455 (RHOA)    05205 Proteoglycans in cancer     706455 (RHOA)    05203 Viral carcinogenesis     706455 (RHOA)   09162 Cancer: specific types    05210 Colorectal cancer     706455 (RHOA)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     706455 (RHOA)   09171 Infectious disease: bacterial    05132 Salmonella infection     706455 (RHOA)    05135 Yersinia infection     706455 (RHOA)    05133 Pertussis     706455 (RHOA)    05152 Tuberculosis     706455 (RHOA)    05100 Bacterial invasion of epithelial cells     706455 (RHOA)   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     706455 (RHOA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mcc04131]     706455 (RHOA)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mcc04147]     706455 (RHOA)    04031 GTP-binding proteins [BR:mcc04031]     706455 (RHOA) Membrane trafficking [BR:mcc04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     706455 (RHOA) Exosome [BR:mcc04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    706455 (RHOA)   Exosomal proteins of other body fluids (saliva and urine)    706455 (RHOA)   Exosomal proteins of colorectal cancer cells    706455 (RHOA)   Exosomal proteins of bladder cancer cells    706455 (RHOA) GTP-binding proteins [BR:mcc04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     706455 (RHOA) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU SRPRB Gtr1_RagA Motif Other DBs NCBI-GeneID:  706455 NCBI-ProteinID:  XP_014986395 Ensembl:  ENSMMUG00000047476 UniProt:  G7MIM5 A0A5S6R6M9 LinkDB All DBs Position 2 AA seq 193 aa AA seqDB search MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD LRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ ARRGKKKSGCLVL NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atggctgccatccggaagaaactagtgattgttggtgacggagcctgtggaaagacatgc ttgctcatagtcttcagcaaggaccagttcccagaggtgtatgtgcccacagtgtttgag aactatgtggcagatatcgaggtggatggaaaacaggtagagttggctttgtgggacaca gctgggcaggaagattatgatcgcctgaggcccctctcctacccagataccgatgttata ctgatgtgtttttccatcgacagccctgatagtttagaaaacatcccagaaaagtggacc ccggaagtcaagcatttctgtcccaacgtgcccatcatcctggttgggaataagaaggat cttcggaatgatgagcacacaaggcgggagctagccaagatgaagcaggagccggtgaaa cctgaagaaggcagagatatggcaaacaggattggtgcttttgggtacatggagtgttca gcaaagaccaaagatggagtgagagaggtttttgaaatggctacgagagctgctctgcaa gctagacgtgggaagaaaaaatctgggtgccttgtcttgtga

DBGET integrated database retrieval system