KEGG   Macaca mulatta (rhesus monkey): 706472
Entry
706472            CDS       T01028                                 

Gene name
PARD3
Definition
(RefSeq) partitioning defective 3 homolog isoform X1
  KO
K04237  partitioning defective protein 3
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04015  Rap1 signaling pathway
mcc04062  Chemokine signaling pathway
mcc04080  Neuroactive ligand-receptor interaction
mcc04144  Endocytosis
mcc04360  Axon guidance
mcc04390  Hippo signaling pathway
mcc04520  Adherens junction
mcc04530  Tight junction
mcc05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    706472 (PARD3)
   04390 Hippo signaling pathway
    706472 (PARD3)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    706472 (PARD3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    706472 (PARD3)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    706472 (PARD3)
   04530 Tight junction
    706472 (PARD3)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    706472 (PARD3)
  09158 Development and regeneration
   04360 Axon guidance
    706472 (PARD3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    706472 (PARD3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mcc01009]
    706472 (PARD3)
Protein phosphatases and associated proteins [BR:mcc01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     706472 (PARD3)
SSDB
Motif
Pfam: PDZ Par3_HAL_N_term PDZ_6 PDZ_2 TPR_11
Other DBs
NCBI-GeneID: 706472
NCBI-ProteinID: XP_028681988
Ensembl: ENSMMUG00000019156
LinkDB
Position
9
AA seq 1372 aa
MKVTVCFGRTRVVVPCGDGHMKVFSLIQQAVTRYRKAIAKDPNYWIQVHRLEHGDGGILD
LDDILCDVADDKDRFLAFSLESEKRMLVAVFDEQDPHHGGDGTSASSTGTQSPEIFGSEL
GTNSVSAFHPYQATSEIEVTPSVLRANMPLHVRRSSDPALIGISTSVSDHNFSSEEPSRK
NPTRWSTTAGFLKQNTAGSPKTCDRKKDENYRSLPRDTSNWSNQFQRDNARSSLSASHPM
VGKWLEKQEQDEDGTEEDNSRVEPVGHADTGLENIPNFSLELVFSDMVKLVEVPNDGGPL
GIHVVPFSARGGRTLGLLVKRLEKGGKAEHENLFHENDCIVRINDGDLRNRRFEQAQHMF
RQAMRTPIIWFHVVPAANKEQYEQLSQSEKNNYYSSRFSPDSQYIDNRSVNSAGLHTVQR
APRLNHPPEQIDSHSRLPHSAHPSGKPPSAPASAPQNVFSATVSSGYNTKKIGKRLNIQL
KKGTEGLGFSITSRDVTIGGSAPIYVKNILPRGAAIQDGRLKAGDRLIEVNGVDLAGKSQ
EEVVSLLRSTKMEGTVSLLVFRQEDAFHPRELNAEPSQMQIPKETKAEDEDIVLTPDGTR
EFLTFEVPLNDSGSAGLGVSVKGNRSKENHADLGIFVKSIINGGAASKDGRLRVNDQLIA
VNGESLLGKTNQDAMETLRRSMSTEGNKRGMIQLIVARRISKCSELKSPGSPPGPELPVE
TALDDRERRISHSLYSGIEGLDESPSRNAALSRIMGESGKYQLSPTVNMPQDDTVIIEDD
RLPVLPPHLSDQSSSSSHDDVGFVTADAGTWAKAAISDSADCSLSPDVDPVLAFQREGFG
RQSMSEKRTKQFSDASQLDFVKTRKSKSMDLGIADETKLNTVDDQKAGSPSRDVGPSLGL
KKSSSLESLQTAVAEVTLNGDIPFHRPRPRIIRGRGCNESFRAAIDKSYDKPVVDDDDEG
METLEEDTEESSRSGRESVSTASDQPSHSLERQMNGNQEKGDKTDRKKDKTGKEKKKDRD
KEKDKMKAKKGMLKGLGDMFRFGKHRKDDKIEKTGKIKIQESFTSEEERMRMKQEQERIQ
AKTREFRERQARERDYAEIQDFHRTFGCDDELMYGGVSSYEGSMALNARPQSPREGHMMD
ALYAQVKKPRNSKPSPVDSNRSTPSNHDRIQRLRQEFQQAKQDEDVEDRRRTYSFEQPWP
NARPAAQSGRHSVSVEVQMQRQRQEERESSQQAQRQYSSLPRQSRKNASSVSQDSWEQNY
SPGEGFQSAKENPRYSSYQGSRNGYLGGHGFNARVMLETQELLRQEQRRKEQQMKKQPPS
EGPSNYDSYKKVQDPSYAPPKGPFRQDVPPSPSQVARLNRLQTPEKGRPFYS
NT seq 4119 nt   +upstreamnt  +downstreamnt
atgaaagtgaccgtgtgcttcggacggacccgggtggtcgtgccgtgcggggacggccac
atgaaagttttcagcctcatccagcaggcggtgacccgctaccggaaggccatcgccaag
gacccaaactactggatacaagtgcatcgcttggaacatggagatggaggaatactagac
cttgatgacattctctgtgatgtagcagacgataaagacagattcctggccttttccttg
gaatcagagaaaagaatgctggtagcagtgtttgatgagcaggatccacatcatggaggt
gatggcaccagtgccagttcaacgggtacccagagcccagagatatttggtagtgagctt
ggcaccaacagtgtctcagcctttcatccttaccaagcaacaagtgaaattgaggtcaca
ccttcagtccttcgagcaaatatgcctcttcatgttcgacgcagtagtgacccagctcta
attggcatctccacttctgtcagtgatcataatttttcctctgaagagccttcaaggaaa
aatcccacacgctggtcaacaacagctggcttcctaaagcagaacactgctgggagtcct
aaaacctgcgacaggaagaaagatgaaaactacagaagcctcccacgggatactagtaac
tggtctaaccaatttcagagagacaatgctcgctcgtctctgagtgccagtcacccaatg
gtgggcaagtggctggagaaacaagaacaggatgaggatgggacagaagaggataacagt
cgtgttgaacctgttggacatgctgacacgggtttggagaatatacccaacttttctctg
gaactagtgttcagtgatatggtaaagctcgtagaagtccccaacgatggagggcctctg
ggaatccatgtagtgcctttcagtgctcgaggcggcagaaccctggggttattagtaaaa
cgattggagaaaggtggtaaagctgaacatgaaaatctttttcatgagaatgattgcatt
gtcaggattaatgatggcgaccttcgaaatagaagatttgaacaagcacaacatatgttt
cgccaagccatgcgtacacccatcatttggttccatgtggttcctgcagcaaataaagaa
cagtatgaacaactatctcaaagtgagaagaacaattactattcaagccgttttagccct
gacagccagtatattgacaacaggagtgtgaacagtgcagggcttcacacggtgcagaga
gcaccccgactgaaccacccgcctgagcagatagactctcactcacgactacctcatagc
gcacacccctcgggaaaaccaccatccgctccagcctcggcacctcagaatgtatttagt
gcgactgtaagcagtggttataacaccaaaaaaataggcaagaggcttaatatccagctt
aagaaaggtacagaaggtttgggattcagcatcacttccagagatgtaacaataggtggc
tcagctccaatctacgtgaagaacatcctcccccggggggcggccattcaggatggccga
cttaaggcaggagacagacttatagaggtaaatggagtagatttagcaggcaaatcccaa
gaggaagttgtttccctgttgagaagcaccaagatggaaggaactgtgagccttctggtc
tttcgccaggaagacgccttccacccaagggaactgaatgcagagccaagccagatgcag
attccaaaagaaacgaaagcagaagatgaggatattgttctcacacctgatggcacgaga
gaatttctgacgtttgaagtcccacttaatgattcgggatctgctggccttggtgtcagt
gtcaaaggtaaccggtcaaaagagaaccacgcagatttgggaatctttgtcaagtccatt
attaatggaggagcagcatctaaagatggaaggcttcgggtgaatgatcaactgatagca
gtaaatggagaatccctgttgggcaagacaaaccaagatgccatggaaaccctaagaagg
tctatgtctactgaaggcaataaacgaggaatgatccagcttattgttgcaaggagaata
agcaagtgcagtgagctaaagtcacctgggagcccccctggacctgagctgcccgttgaa
acagcgttggatgatagagaacgaagaatttcccattccctctacagtgggattgagggg
cttgatgaatcgcctagcagaaatgctgccctcagtaggataatgggtgagtcaggtaaa
taccagctgtcccctacagtgaatatgccccaagatgacactgtcattatagaagatgac
aggttgccagtgcttcctccacatctctctgaccagtcctcttccagctcgcatgatgat
gtggggttcgtgacggcagatgctggtacttgggccaaggctgcaatcagtgattcagcc
gactgctctttgagtccagatgttgatccagttcttgcttttcaacgagaaggatttgga
cgtcagagtatgtcagaaaaacgcacaaagcaattttcagatgccagtcaattggatttc
gttaaaacacgaaaatcaaaaagcatggatttaggtatagctgacgagactaaactcaat
acagtggatgaccagaaagcaggttctcccagcagagatgtgggtccttccctgggtctg
aaaaagtcaagctcattagagagtctgcagaccgcagttgccgaggtgactttgaatggg
gatattcctttccatcgcccacggccacggataatcagaggcaggggatgcaatgagagc
ttcagagctgccatcgacaaatcttatgataaacccgtggtagatgatgatgatgaaggc
atggagaccttggaagaagacacagaagaaagttcaagatcagggagagagtctgtatcc
acagccagtgatcagccttcccactctctggagagacaaatgaatggaaaccaagagaaa
ggtgataagactgatagaaaaaaggataaaactggaaaagaaaagaagaaagatagagat
aaggagaaggataaaatgaaagccaagaagggaatgctgaagggcttgggagacatgttc
aggtttggcaaacatcgaaaagatgacaagattgagaaaacgggtaaaataaaaatacag
gaatcctttacgtcagaagaggagaggatgcgaatgaagcaggaacaggagaggattcaa
gccaaaactcgagaatttagggaacgacaagctcgagagcgtgactatgctgaaatccaa
gattttcatcggacgtttggctgtgatgatgaattgatgtatgggggagtttcttcttat
gaaggttccatggctctcaacgctagacctcagagcccacgagaagggcacatgatggat
gctttgtatgcccaagtcaagaagccgcggaattccaaaccctcacctgtagacagtaac
agatcaactcctagcaatcatgatcggatacagcgtctgaggcaagaatttcagcaagca
aagcaggatgaagatgtagaagatcgtcgacggacctacagctttgagcaaccctggccg
aacgcacggccggcggcgcagagcgggcggcactcggtgtccgtggaagtgcagatgcag
cggcagcggcaggaggagcgcgaaagctcccagcaggcccagcgccagtacagctctctg
cctcggcaaagcaggaaaaacgccagctcggtctcccaggactcttgggagcagaactac
tcccccggggaaggcttccagagtgccaaagagaaccccaggtactccagctaccaaggc
tccaggaacggctacctgggaggacacggcttcaacgccagggtcatgctggaaactcag
gagctccttcgccaggaacagaggcggaaggagcagcagatgaagaagcagcctccttcc
gaggggccgagcaactatgactcgtataagaaagtccaggaccctagttacgcccctccc
aaggggcccttccggcaagatgtgccgccctccccttctcaggttgcgaggctgaacaga
cttcagactcctgagaaagggaggcccttctactcctga

DBGET integrated database retrieval system