KEGG   Macaca mulatta (rhesus monkey): 706539
Entry
706539            CDS       T01028                                 

Gene name
PLPP1
Definition
(RefSeq) phospholipid phosphatase 1 isoform X1
  KO
K01080  phosphatidate phosphatase [EC:3.1.3.4]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc00561  Glycerolipid metabolism
mcc00564  Glycerophospholipid metabolism
mcc00565  Ether lipid metabolism
mcc00600  Sphingolipid metabolism
mcc01100  Metabolic pathways
mcc04072  Phospholipase D signaling pathway
mcc04666  Fc gamma R-mediated phagocytosis
mcc04975  Fat digestion and absorption
mcc05231  Choline metabolism in cancer
Module
mcc_M00089  Triacylglycerol biosynthesis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    706539 (PLPP1)
   00564 Glycerophospholipid metabolism
    706539 (PLPP1)
   00565 Ether lipid metabolism
    706539 (PLPP1)
   00600 Sphingolipid metabolism
    706539 (PLPP1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    706539 (PLPP1)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    706539 (PLPP1)
  09154 Digestive system
   04975 Fat digestion and absorption
    706539 (PLPP1)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    706539 (PLPP1)
Enzymes [BR:mcc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.4  phosphatidate phosphatase
     706539 (PLPP1)
SSDB
Motif
Pfam: PAP2 PAP2_C MerC COX4 TPPK_C
Other DBs
NCBI-GeneID: 706539
NCBI-ProteinID: XP_014995565
UniProt: I2CT37
LinkDB
Position
6
AA seq 285 aa
MFDKTRLPYVALDVLCVLLASMPMAVLKLGQIYPFQRGFFCKDNSINYPYHDSTVTSTVL
ILVGVGLPISSMILGETLSVYCNLLHSNSFIRNNYIATIYKAIGTFLFGAAASQSLTDIA
KYSIGRLRPHFLDVCDPDWSKINCSDGYIENYICRGNAEKVKEGRLSFYSGHSSFSMYCM
LFVALYLQARMKGDWARLLRPTLQFGLVAVSIYVGLSRVSDYKHHWSDVLTGLIQGALVA
VLVAVYVSDFFKERTSFKERKEEDSHTTLHETSTTGNHYQSNHQP
NT seq 858 nt   +upstreamnt  +downstreamnt
atgtttgacaagacgcggctgccgtacgtggccctcgatgtgctctgcgtgttgctggct
tccatgcctatggctgttctaaaattgggccaaatatatccatttcagagaggctttttc
tgtaaagacaacagcatcaactatccgtaccatgacagtaccgtcacatccactgtcctc
atcctagtaggggttggcttgcccatttcctctatgattcttggagaaaccctgtctgtt
tactgtaaccttttgcactcaaattcctttatcaggaataactacatagccactatttac
aaagccattggaacctttttatttggtgcagctgctagtcagtccctgactgacattgcc
aagtattcaataggcagactgcggcctcacttcttggatgtttgtgatccagattggtca
aaaatcaactgcagcgatggttacattgaaaactacatatgtcgagggaatgcagaaaaa
gttaaggaaggcaggttgtccttctactcaggccactcttcgttctccatgtactgcatg
ctgtttgtggcactttatcttcaagccaggatgaagggagactgggcaagactcttacgc
cccacactgcaatttggtcttgttgccgtatccatttatgtgggcctttctcgagtttct
gattacaaacaccactggagtgatgtgttgactggactcattcagggagctctggttgca
gtattagttgctgtatatgtatcggatttcttcaaagaaagaacttcttttaaagaaaga
aaagaggaggactctcacacaactctgcatgaaacatcaacaacggggaatcactatcag
agcaatcaccagccttga

KEGG   Macaca mulatta (rhesus monkey): 715993
Entry
715993            CDS       T01028                                 

Gene name
PLPP3
Definition
(RefSeq) phospholipid phosphatase 3
  KO
K01080  phosphatidate phosphatase [EC:3.1.3.4]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc00561  Glycerolipid metabolism
mcc00564  Glycerophospholipid metabolism
mcc00565  Ether lipid metabolism
mcc00600  Sphingolipid metabolism
mcc01100  Metabolic pathways
mcc04072  Phospholipase D signaling pathway
mcc04666  Fc gamma R-mediated phagocytosis
mcc04975  Fat digestion and absorption
mcc05231  Choline metabolism in cancer
Module
mcc_M00089  Triacylglycerol biosynthesis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    715993 (PLPP3)
   00564 Glycerophospholipid metabolism
    715993 (PLPP3)
   00565 Ether lipid metabolism
    715993 (PLPP3)
   00600 Sphingolipid metabolism
    715993 (PLPP3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    715993 (PLPP3)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    715993 (PLPP3)
  09154 Digestive system
   04975 Fat digestion and absorption
    715993 (PLPP3)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    715993 (PLPP3)
Enzymes [BR:mcc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.4  phosphatidate phosphatase
     715993 (PLPP3)
SSDB
Motif
Pfam: PAP2 PAP2_C PAP2_3 Herpes_LMP1
Other DBs
NCBI-GeneID: 715993
NCBI-ProteinID: XP_014995931
Ensembl: ENSMMUG00000002200
UniProt: H9G166
LinkDB
Position
1
AA seq 311 aa
MQNYKYDKAIVPESKNGGSPALNNNPRRSGSKRVLLICLDLFCLFMAGLPFLIIETSTIK
PYHRGFYCNDESIKYPLKTGETINDAVLCAVGIVIAILAIITGEFYRIYYLKKSRSTIQN
PYVAALYKQVGCFLFGCAISQSFTDIAKVSIGRLRPHFLSVCNPDFSQINCSEGYIQNYR
CRGDDSKVQEARKSFFSGHASFSMYTMLYLVLYLQARFTWRGARLLRPLLQFTLIMMAFY
TGLSRVSDHKHHPSDVLAGFAQGALVACCIVFFVSDLFKTKTTLSLPAPAIRKEILSPVD
IIDRNNHHNMV
NT seq 936 nt   +upstreamnt  +downstreamnt
atgcaaaactacaagtacgacaaagcgatcgtcccggagagcaagaacggcggcagcccg
gcgctcaacaacaacccgaggaggagcggcagcaagcgggtgctgctcatctgcctagac
ctcttctgcctcttcatggcgggcctccccttccttatcatcgagacaagcaccatcaag
ccttaccaccgagggttttactgcaatgatgagagcatcaagtacccactgaaaactggt
gagacaataaatgacgctgtgctctgcgccgtggggatcgtcattgccatcctcgcgatc
atcacgggggaattctaccggatctattacctgaagaagtcgcggtcgacgattcagaac
ccctacgtggcagcactctataagcaagtgggctgcttcctctttggctgtgccatcagc
cagtctttcacagacattgccaaagtgtccatagggcgcctgcgtcctcacttcttgagt
gtctgcaaccctgatttcagccagatcaactgctctgaaggctacattcagaactacaga
tgcagaggtgatgatagcaaagtccaggaagccaggaagtccttcttctctggccatgcc
tccttctccatgtacactatgctgtatttggtgctatacctgcaggcccgcttcacttgg
cgaggagcccgcctgctccggcccctcctgcagttcaccttgatcatgatggccttctac
acgggactgtcccgcgtgtcagaccacaagcaccatcccagtgatgtgctggcaggattt
gctcaaggagccctggtggcttgctgcatagttttcttcgtgtctgacctcttcaagact
aagacgacgctctccctgcctgcccctgctatccggaaggaaatcctttcacctgtggac
attattgacaggaacaatcaccacaacatggtgtag

KEGG   Macaca mulatta (rhesus monkey): 721004
Entry
721004            CDS       T01028                                 

Gene name
PLPP2
Definition
(RefSeq) phospholipid phosphatase 2 isoform X1
  KO
K01080  phosphatidate phosphatase [EC:3.1.3.4]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc00561  Glycerolipid metabolism
mcc00564  Glycerophospholipid metabolism
mcc00565  Ether lipid metabolism
mcc00600  Sphingolipid metabolism
mcc01100  Metabolic pathways
mcc04072  Phospholipase D signaling pathway
mcc04666  Fc gamma R-mediated phagocytosis
mcc04975  Fat digestion and absorption
mcc05231  Choline metabolism in cancer
Module
mcc_M00089  Triacylglycerol biosynthesis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    721004 (PLPP2)
   00564 Glycerophospholipid metabolism
    721004 (PLPP2)
   00565 Ether lipid metabolism
    721004 (PLPP2)
   00600 Sphingolipid metabolism
    721004 (PLPP2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    721004 (PLPP2)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    721004 (PLPP2)
  09154 Digestive system
   04975 Fat digestion and absorption
    721004 (PLPP2)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    721004 (PLPP2)
Enzymes [BR:mcc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.4  phosphatidate phosphatase
     721004 (PLPP2)
SSDB
Motif
Pfam: PAP2 PAP2_C LrgB
Other DBs
NCBI-GeneID: 721004
NCBI-ProteinID: XP_014977739
Ensembl: ENSMMUG00000023716
UniProt: H9G165
LinkDB
Position
19
AA seq 287 aa
MQRRWVFVLLDVLCLLVASLPFAILTLVNAPYKRGFYCGDDSIRYPYRPDTITHGVMAGV
TTTATVVLVSAGEAYLVYTDRLYSRSDFNNYVAAVYKVLGAFLFGAAVSQSLTDLAKYMI
GRLRPNFLAVCDPDWSRVNCSVYVQLEKVCRGNPADVTEARLSFYSGHSSFGMYCMLFLA
LYVQARLCWKWARLLRPTVQFFLVAFALYVGYTRVSDYKHHWSDVLVGLLQGALVAGLTV
RYISDFFKARPPQHCLKEEELERKPSLSLTLTLGEADHNHCGYPHSS
NT seq 864 nt   +upstreamnt  +downstreamnt
atgcagcggaggtgggtcttcgtgctgctcgacgtgctgtgcttactggttgcctccctg
cccttcgctatcctgacgctggtgaacgccccgtataagcgaggattttactgcggggat
gactccatccggtacccctaccgtccagataccatcacccatggggtcatggctggggtc
accaccacggccaccgtcgtccttgtctcggctggggaagcttacctggtgtacacagac
cggctctattctcgctccgacttcaacaactacgtggctgccgtctacaaggtgctgggg
gccttcctgtttggggctgccgtgagccagtctctgacagacttggccaagtacatgatc
gggcgtctgcggcccaacttcctggccgtctgcgaccctgactggagccgggtgaactgc
tcggtgtatgtgcagctggagaaggtgtgcaggggaaaccctgctgacgtcaccgaggcc
aggctgtctttctactcgggacactcttcctttgggatgtactgcatgctgttcttggcg
ctctatgtgcaggcccggctctgttggaagtgggcacggctgctgcggcccacagtccag
ttcttcctggtggcctttgccctctacgtgggctacacccgcgtgtctgattacaaacac
cactggagcgatgtccttgttggactcctgcagggggcactggtggctggcctcactgtc
cgctacatctcagacttcttcaaagcccgacccccacagcactgtctgaaggaggaggag
ctggaacggaagcccagcctgtcactgacgttgaccctgggcgaggctgaccacaaccac
tgtgggtacccgcactcctcctga

DBGET integrated database retrieval system