KEGG   Macaca mulatta (rhesus monkey): 706726
Entry
706726            CDS       T01028                                 

Gene name
RNF125
Definition
(RefSeq) E3 ubiquitin-protein ligase RNF125 isoform X1
  KO
K12170  E3 ubiquitin-protein ligase RNF125 [EC:2.3.2.27]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04622  RIG-I-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    706726 (RNF125)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mcc04121]
    706726 (RNF125)
Enzymes [BR:mcc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     706726 (RNF125)
Ubiquitin system [BR:mcc04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    706726 (RNF125)
SSDB
Motif
Pfam: zf_C2HC_14 zf-Di19 zf-C3HC4_2 zf-C3HC4_4 zf-RING_UBOX zf-C3HC4 zf-RING_2 zf-C3HC4_3 zf-RING_5 Prok-RING_4 U-box zf-Nse zf-RING_10 Rad50_zn_hook zf-RING_6 zf-rbx1 zf-C2H2_4
Other DBs
NCBI-GeneID: 706726
NCBI-ProteinID: XP_001099929
UniProt: G7NKK2
LinkDB
Position
18
AA seq 232 aa
MGSVLSSDSGKSAPPSATPRALERRGDPQLPVTSFDCAVCLEVLHQPVRTRCGHVFCRSC
IATSLKNNKWTCPYCRAYLPSEGVPATDVAKRMKSEYKNCAECDTLVCLSEMRAHIRTCQ
KYIDKYGPLQELEETAARCVCPFCQRELDEDSLLDHCITHHRSERRPVFCPLCRLIPDEN
PSSFSGSLIRHLQVSHTLFYDDFIDFNIIEEALIRRVLDRSLLEYVNQSNAT
NT seq 699 nt   +upstreamnt  +downstreamnt
atgggctccgtgctgagcagcgacagcggcaaatcggctcccccctctgccaccccgcgg
gccctggagcgcaggggggacccgcagttgcccgtcacgtccttcgattgcgccgtgtgc
cttgaggtgttacaccagcctgtccggacccgctgtggccacgtattctgccgttcctgt
attgctaccagtctaaagaacaacaaatggacctgtccttattgccgggcatatcttcct
tcagaaggagttccagcaactgatgtagccaaaagaatgaaatcagagtataagaactgc
gctgagtgtgacaccctggtttgcctcagtgaaatgagggcacatattcggacttgtcag
aagtacatagataagtatggaccactacaagaacttgaggagacagcagcaaggtgtgta
tgtcccttttgtcaaagggaactggatgaagacagcttgctggatcactgtattactcat
cacagatcggaaaggaggcctgtgttctgcccactttgccgtttaatacccgatgagaat
ccaagcagcttcagtggcagtttaataagacatcttcaagttagtcacactttgttttat
gatgatttcatagattttaatataattgaggaagctcttatccgaagagtcttagaccgg
tcacttcttgaatatgtgaatcagtcgaacgccacataa

DBGET integrated database retrieval system