KEGG   Macaca mulatta (rhesus monkey): 706777Help
Entry
706777            CDS       T01028                                 

Gene name
TGM2
Definition
(RefSeq) transglutaminase 2
  KO
K05625  transglutaminase 2 [EC:2.3.2.13]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09160 Human Diseases
  09163 Neurodegenerative diseases
   05016 Huntington disease
    706777 (TGM2)
Enzymes [BR:mcc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     706777 (TGM2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_C Transglut_N Transglut_core A2M_N
Motif
Other DBs
NCBI-GeneID: 706777
NCBI-ProteinID: XP_015004523
Ensembl: ENSMMUG00000018925
UniProt: F7B5B4
LinkDB All DBs
Position
10
AA seq 687 aa AA seqDB search
MAEDLVLERCDLELETNGRDHHTADLCREKLVVRRGQPFWLTLHFEGRNYEASVDSLTFS
VVTGPAPSQEAGTKARFPLRDAVEEGDWTATVVDQQDCTLSLQLTTPANAPIGLYRLSLE
ASTGYQGSSFVLGHFILLFNAWCPADAVYLDSEEERREYVLTQQGFIYQGSAKFIKSIPW
NFGQFEDGILDICLILLDVNPKFLKNAGRDCSRRSSPVYVGRVVSGMVNCNDDQGVLLGR
WDNNYGDGVSPMSWIGSVDILRRWKNHGCQRVKYGQCWVFAAVACTVLRCLGIPTRVVTN
YNSAHDQNSNLLIEYFRNEFGEIQGDKSEMIWNFHCWVESWMTRPDLQPGYEGWQALDPT
PQEKSEGTYCCGPVPVRAIKEGDLSTKYDAPFVFAEVNADVVDWIQQDDGSVSKSINRSL
TVGLKISTKSVGRDEREDITHTYKYPEGSSEEREAFTRANHLNKLAEKEETGMAMRIRVG
QSMNMGSDFDVFAHITNNTAEEYVCRLLLCARTVSYNGILGPECGTKHLLNLNLEPFSEK
SIPLCILYEKYRDCLTESNLIKVRALLVEPVINSYLLAERDLYLENPEIKIRILGEPKQK
RKLVAEVSLQNPLPVALEGCTFTVEGAGLTEEQKTVEIPDPVEAGEEVKVRMDLLPLHMG
LHKLVVNFESDKLKAVKGFRNVIIGPA
NT seq 2064 nt NT seq  +upstreamnt  +downstreamnt
atggccgaggatctggtcttggagaggtgtgatctggagctggagaccaatggccgagac
caccacacggccgacctgtgccgggagaagctggtggtgcgacggggccagcccttctgg
ctgaccctgcactttgagggccgcaactacgaggccagtgtagacagtcttaccttcagt
gtcgtgaccggcccagcccccagccaggaggccgggaccaaggcccgttttccactacga
gatgctgtggaggagggtgactggacggccaccgtggtggaccagcaagactgcaccctc
tcgctgcagctcaccaccccggccaacgcccccatcggcctgtatcgcctcagcctggag
gcctccactggctaccagggatccagctttgtgctgggccacttcatcttgctcttcaat
gcctggtgcccagcggacgctgtgtacctggactcggaagaggagcggcgggagtacgtc
ctcacccagcagggctttatctaccagggctcggccaagttcatcaagagcataccttgg
aattttgggcagtttgaagatgggatcctagacatctgcctgatccttctagatgtcaac
cccaagttcctgaagaacgccggccgtgactgctcccgccgcagcagccccgtctacgtg
ggtcgggtggtgagcggcatggtcaactgcaacgatgaccagggtgtgctgctgggacgc
tgggacaacaactacggggacggtgtcagtcccatgtcctggatcggcagcgtggacatc
ctgcggcgctggaagaaccacggctgccagcgcgtcaagtacggccagtgctgggtcttt
gccgccgtggcctgcacagtgctgaggtgcctgggcatccccacccgcgtcgtgaccaac
tacaactcagcccatgaccagaacagcaaccttctcatcgagtacttccgcaatgagttt
ggggagatccagggtgacaagagcgagatgatctggaacttccactgctgggtggagtca
tggatgaccaggccggacctgcagccggggtacgagggctggcaggccctggacccaacg
ccccaggagaagagcgaagggacgtactgctgtggcccagttccagttcgtgccatcaag
gagggcgacctgagcaccaagtacgatgcgccctttgtctttgcggaggtcaatgccgac
gtggtggactggatccagcaagacgacgggtccgtgagcaaatccatcaaccgttccctg
accgttgggctgaagatcagcactaagagtgtgggccgagacgagcgggaggatatcacc
cacacctacaaatacccagaggggtcctcagaggagagggaggccttcacaagggccaac
cacctgaacaaactggccgagaaggaggagacagggatggccatgcggatccgtgtgggc
cagagcatgaacatgggcagtgactttgacgtctttgcccacataaccaacaacactgcc
gaggagtacgtctgccgcctcctgctctgtgcccgcaccgtcagctacaatgggatcttg
gggcccgagtgtggcaccaagcacctgctcaacctcaacctggagcctttctctgagaag
agcattcctctttgcatcctctatgagaagtaccgtgactgcctcacagagtccaacctc
atcaaggtgcgggccctgctcgtggagccagttatcaacagctacctgctggctgagagg
gacctctacctggagaatccagaaatcaagatccggatcctgggggagcccaaacagaaa
cgcaagctggtggccgaagtgtccctgcagaacccgctccctgtggccctggaaggctgc
accttcactgtggagggggccgggctaaccgaggagcagaagacagtggagatcccagac
cccgtggaggcaggggaggaagttaaggtgagaatggacctgctgccgctccacatgggc
ctccacaagctggtggtgaacttcgagagcgacaagctgaaggctgtgaagggcttccgg
aatgtcatcattggccccgcctaa

DBGET integrated database retrieval system