KEGG   Macaca mulatta (rhesus monkey): 706946
Entry
706946            CDS       T01028                                 

Gene name
IL3
Definition
(RefSeq) interleukin-3 precursor
  KO
K04736  interleukin 3
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04060  Cytokine-cytokine receptor interaction
mcc04151  PI3K-Akt signaling pathway
mcc04210  Apoptosis
mcc04630  JAK-STAT signaling pathway
mcc04640  Hematopoietic cell lineage
mcc04664  Fc epsilon RI signaling pathway
mcc05200  Pathways in cancer
mcc05202  Transcriptional misregulation in cancer
mcc05221  Acute myeloid leukemia
mcc05310  Asthma
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    706946 (IL3)
   04151 PI3K-Akt signaling pathway
    706946 (IL3)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    706946 (IL3)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    706946 (IL3)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    706946 (IL3)
   04664 Fc epsilon RI signaling pathway
    706946 (IL3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    706946 (IL3)
   05202 Transcriptional misregulation in cancer
    706946 (IL3)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    706946 (IL3)
  09163 Immune disease
   05310 Asthma
    706946 (IL3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcc04052]
    706946 (IL3)
   00536 Glycosaminoglycan binding proteins [BR:mcc00536]
    706946 (IL3)
Cytokines and growth factors [BR:mcc04052]
 Cytokines
  Interleukins
   706946 (IL3)
Glycosaminoglycan binding proteins [BR:mcc00536]
 Heparan sulfate / Haparin
  Cytokines
   706946 (IL3)
SSDB
Motif
Pfam: IL3
Other DBs
NCBI-GeneID: 706946
NCBI-ProteinID: NP_001095204
Ensembl: ENSMMUG00000016912
UniProt: P25140 G7MTY2
LinkDB
Position
6
AA seq 143 aa
MSRLPVLLLLHLLVSPGLQAPMTQTTSLKTSWAKCSNMIDEIITHLNQPPLPSPDFNNLN
EEDQTILVEKNLRRSNLEAFSKAVKSLQNASAIESILKNLPPCLPMATAAPTRPPIRITN
GDRNDFRRKLKFYLKTLENEQAQ
NT seq 432 nt   +upstreamnt  +downstreamnt
atgagccgcctgcccgtcctgctcctgctccatctcctggtcagccccggactccaagct
cccatgacccagacaacgtccttgaagacaagctgggctaagtgctctaacatgatcgat
gaaattataacacacttaaaccagccacctttgccttcaccggacttcaacaacctcaat
gaggaagaccaaaccattctggtggaaaaaaaccttcgaaggtcaaacctggaggcattc
agtaaggctgtcaagagtttacagaacgcatcagcaatcgagagcattcttaagaatctc
ccaccatgcctgcccatggccacggccgcacccacgcgacctccaatccgtatcacgaac
ggtgaccggaatgacttccggaggaaactgaagttctatctgaaaacccttgagaatgag
caggctcaatag

DBGET integrated database retrieval system