KEGG   Macaca mulatta (rhesus monkey): 707234
Entry
707234            CDS       T01028                                 

Gene name
IFNK
Definition
(RefSeq) interferon kappa
  KO
K05441  interferon kappa
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04060  Cytokine-cytokine receptor interaction
mcc04622  RIG-I-like receptor signaling pathway
mcc04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    707234 (IFNK)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    707234 (IFNK)
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    707234 (IFNK)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcc04052]
    707234 (IFNK)
Cytokines and growth factors [BR:mcc04052]
 Cytokines
  Interferons
   707234 (IFNK)
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 707234
NCBI-ProteinID: NP_001181223
UniProt: A0A5F7Z7I7 F7G0T5
LinkDB
Position
15
AA seq 207 aa
MSTIPNMIQKCLWLEFLMGTFIAGTLSLDCNLLNVHLRRVTWQNLRLLSSMSNSFPVECL
RENIAFELPQEFLQYTQHMKRDIKKAFYEMSLQTFNIFSQHTFKSGKERHVKQIQIGLDQ
QAEYLNQCLEEDKNENEDMKEMKENEMKPSEARVPQLSNLELRRYFNRIDNFLKEKKYSD
CAWEIVRVEIRRCLYYFYKFTALFRRK
NT seq 624 nt   +upstreamnt  +downstreamnt
atgagcaccatacccaacatgattcaaaagtgtctgtggcttgagttccttatgggtacg
ttcattgctggcaccctatccctggactgtaacttactgaatgttcacctgagaagagtc
acctggcaaaatctgagacttctgagtagtatgagcaattcatttcctgtagaatgtcta
cgagaaaacatagcttttgagttgccccaagaatttctacaatacacccagcatatgaag
agggacatcaagaaggccttctatgaaatgtccctacagacattcaacatcttcagccaa
cacaccttcaaatctgggaaagagagacacgtcaaacaaatccaaataggacttgatcag
caagcagagtacctgaaccaatgcttggaggaagacaagaatgaaaatgaagacatgaaa
gaaatgaaagaaaatgagatgaaaccctcagaagccagggtcccccagctgagtaacctc
gaactgaggagatatttcaacaggatagacaatttcctgaaagaaaagaaatacagtgac
tgtgcctgggagattgtccgagtagaaatcagaagatgtttgtactacttttacaaattc
acagctctattcaggaggaaataa

DBGET integrated database retrieval system