KEGG   Macaca mulatta (rhesus monkey): 707329
Entry
707329            CDS       T01028                                 

Gene name
CXCR4
Definition
(RefSeq) C-X-C chemokine receptor type 4
  KO
K04189  C-X-C chemokine receptor type 4
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04020  Calcium signaling pathway
mcc04060  Cytokine-cytokine receptor interaction
mcc04061  Viral protein interaction with cytokine and cytokine receptor
mcc04062  Chemokine signaling pathway
mcc04144  Endocytosis
mcc04360  Axon guidance
mcc04670  Leukocyte transendothelial migration
mcc04672  Intestinal immune network for IgA production
mcc04810  Regulation of actin cytoskeleton
mcc05163  Human cytomegalovirus infection
mcc05170  Human immunodeficiency virus 1 infection
mcc05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    707329 (CXCR4)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    707329 (CXCR4)
   04061 Viral protein interaction with cytokine and cytokine receptor
    707329 (CXCR4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    707329 (CXCR4)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    707329 (CXCR4)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    707329 (CXCR4)
   04672 Intestinal immune network for IgA production
    707329 (CXCR4)
   04062 Chemokine signaling pathway
    707329 (CXCR4)
  09158 Development and regeneration
   04360 Axon guidance
    707329 (CXCR4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    707329 (CXCR4)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    707329 (CXCR4)
   05163 Human cytomegalovirus infection
    707329 (CXCR4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mcc04030]
    707329 (CXCR4)
   04050 Cytokine receptors [BR:mcc04050]
    707329 (CXCR4)
   04090 CD molecules [BR:mcc04090]
    707329 (CXCR4)
G protein-coupled receptors [BR:mcc04030]
 Rhodopsin family
  Chemokine
   CXC Chemokine
    707329 (CXCR4)
Cytokine receptors [BR:mcc04050]
 Chemokine receptors
  CXC Chemokine
   707329 (CXCR4)
CD molecules [BR:mcc04090]
 Proteins
  707329 (CXCR4)
SSDB
Motif
Pfam: 7tm_1 CXCR4_N 7TM_GPCR_Srsx Cybc1_Eros T4SS_pilin
Other DBs
NCBI-GeneID: 707329
NCBI-ProteinID: NP_001036110
Ensembl: ENSMMUG00000011918
UniProt: P79394 H9ZDD5
LinkDB
Position
12
AA seq 352 aa
MEGISIYTSDNYTEEMGSGDYDSIKEPCFREENAHFNRIFLPTIYSIIFLTGIVGNGLVI
LVMGYQKKLRSMTDKYRLHLSVADLLFVITLPFWAVDAVANWYFGNFLCKAVHVIYTVNL
YSSVLILAFISLDRYLAIVHATNSQKPRKLLAEKVVYVGVWIPALLLTIPDFIFASVSEA
DDRYICDRFYPNDLWVVVFQFQHIMVGLILPGIVILSCYCIIISKLSHSKGHQKRKALKT
TVILILAFFACWLPYYIGISIDSFILLEIIKQGCEFENTVHKWISITEALAFFHCCLNPI
LYAFLGAKFKTSAQHALTSVSRGSSLKILSKGKRGGHSSVSTESESSSFHSS
NT seq 1059 nt   +upstreamnt  +downstreamnt
atggaggggatcagtatatacacttcagataactacaccgaggaaatgggctcaggggac
tatgactccataaaggaaccctgcttccgtgaagaaaatgctcatttcaataggatcttc
ctgcccaccatctactccatcatcttcttgactggcattgttggcaatggattggtcatc
ttggtcatgggttaccagaagaaactgagaagcatgacggacaagtacaggctacacctg
tcagtggctgaccttctctttgtcatcacgcttcccttctgggcagttgatgccgtggca
aactggtactttgggaacttcctgtgcaaggcagtccatgtcatctacacagtcaacctc
tacagcagtgtcctcatcctggccttcatcagtctggaccgctacctggccatcgtccac
gccaccaacagtcagaagccaaggaagctgttggctgaaaaggtggtctatgttggagtc
tggatccctgccctcctgctgactattcccgacttcatctttgccagcgtcagtgaggca
gatgacagatatatctgtgaccgcttctaccccaatgacttgtgggtggttgtgttccag
tttcagcacatcatggttggccttatcctgcctggtatcgtcatcctgtcctgctattgc
attatcatctccaagctgtcacactccaagggccaccagaagcgcaaggccctcaagacc
acggtcatcctcatcctggctttcttcgcctgctggctgccttattacattgggatcagc
atcgactccttcatcctcctggaaatcatcaagcaagggtgtgagtttgagaacactgtg
cacaagtggatttccatcaccgaggccctagctttcttccactgttgtctgaaccccatc
ctctatgctttccttggagccaaatttaaaacctctgcccagcacgcactcacctctgtg
agcagagggtccagcctcaagatcctctccaaaggaaagcgagggggacactcgtctgtt
tccactgagtctgagtcttcaagttttcactccagctaa

DBGET integrated database retrieval system