KEGG   Macaca mulatta (rhesus monkey): 707361
Entry
707361            CDS       T01028                                 

Gene name
MYLK4
Definition
(RefSeq) myosin light chain kinase family member 4 isoform X1
  KO
K00907  myosin-light-chain kinase [EC:2.7.11.18]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04020  Calcium signaling pathway
mcc04022  cGMP-PKG signaling pathway
mcc04270  Vascular smooth muscle contraction
mcc04371  Apelin signaling pathway
mcc04510  Focal adhesion
mcc04611  Platelet activation
mcc04810  Regulation of actin cytoskeleton
mcc04921  Oxytocin signaling pathway
mcc04971  Gastric acid secretion
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    707361 (MYLK4)
   04020 Calcium signaling pathway
    707361 (MYLK4)
   04022 cGMP-PKG signaling pathway
    707361 (MYLK4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    707361 (MYLK4)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    707361 (MYLK4)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    707361 (MYLK4)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    707361 (MYLK4)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    707361 (MYLK4)
  09154 Digestive system
   04971 Gastric acid secretion
    707361 (MYLK4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcc01001]
    707361 (MYLK4)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.18  myosin-light-chain kinase
     707361 (MYLK4)
Protein kinases [BR:mcc01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   707361 (MYLK4)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo APH Kinase-like
Other DBs
NCBI-GeneID: 707361
NCBI-ProteinID: XP_014990914
LinkDB
Position
4
AA seq 530 aa
MEPLALKSLVSKINILPHLTKKATAEQHEIKSHINLNRGSKWHFREKILPLVVDTCLFRR
FIRLRVKTVTRDFHSQFEFCKISLYLLECMLYTWNGSSSSMLSYQCQEKEALKSQNRVLI
YKSETEGDENHTPESSLIGLTTKMLKVKRLEEFNTCYNSNELEKMAFFQCREEVEKVKHF
LEENSGDQDSRPEHNEAKEVWSNADLTERMPVKSKRTSALAVDIPAPPAPFDHRIVTAKQ
GAVNSFYTVSKTEILGGGRFGQVHKCEETATGLKLAAKIIKTRGMKDKEEVKNEISVMNQ
LDHANLIQLYDAFESKDDIVLVMEYVDGGELFDRIIDENDNLTELDTILFMKQICEGIRH
MHQMYILHLDLKPENILCVNRDAKQIKIIDFGLARRYKPREKLKVNFGTPEFLAPEVVNY
DFVSFPTDMWSVGVIAYMLLSGLSPFLGDNDAETLNNILACRWDLEDEEFQDISEEAKEF
ISKLLIKEKSWRISASEALKHPWLSDHKLHSRLNAQKKKKKNRGSDVQDL
NT seq 1593 nt   +upstreamnt  +downstreamnt
atggagccattggccttgaaaagcctggtgtctaaaattaatattcttccccatctgact
aagaaggcaacagctgagcaacatgagatcaagagccatattaatttaaacagaggctca
aagtggcatttcagagagaagatacttcctctcgtagtggacacttgtcttttcagaaga
tttatacgactgagagtcaaaactgtcaccagagacttccatagtcagtttgaattctgc
aaaatttctctttatcttctggaatgtatgctctacacttggaatggctcaagctcttcg
atgttatcctatcaatgtcaagagaaagaagcactgaagagtcagaatcgtgtcttgatt
tataaatcggagacagagggagatgaaaaccacactccagaaagtagcttaattggactc
actactaagatgttgaaagtgaagaggctggaagaattcaacacgtgttacaacagcaac
gagctggagaaaatggccttttttcagtgcagggaagaggtggagaaagtgaagcatttt
ctggaagaaaattctggggaccaggattcaagacctgaacataatgaggcgaaggaggtg
tggtcaaacgccgacctgacggaaaggatgcctgtcaaaagcaaaaggacatcagccctt
gcagttgacatcccggctcctcctgccccatttgatcatcgtattgtgacagccaagcaa
ggagcggtcaacagcttctatactgtgagcaagacggaaatcctaggaggagggcgtttc
ggccaagttcacaagtgtgaggagacggccacaggtctgaagctggcagccaaaatcatc
aagaccagaggcatgaaggacaaggaggaggtgaagaacgagatcagcgtcatgaaccag
ctggaccacgcgaacctcatccagctgtacgatgcctttgagtctaaggacgacattgtc
ctggtcatggagtacgtggacggtggggagctgtttgaccgcatcatcgatgagaacgac
aatctgacggaacttgataccatcctgttcatgaagcagatatgtgagggcataaggcac
atgcatcagatgtacattctccacttggacctgaagcctgagaatatcctgtgtgtgaat
cgggatgctaagcaaataaaaattattgattttggattggccagaagatacaaacccaga
gagaagctgaaggtgaactttggaaccccagaatttctcgcccctgaagttgttaactat
gactttgtttcctttccaaccgacatgtggagtgtgggggtcatcgcctatatgctactt
agcggtttgtcccctttcctgggtgacaatgatgccgagacgctgaacaacatcctggcc
tgcaggtgggacttagaggatgaagaatttcaggacatctcagaggaggccaaggagttc
atctccaagcttctgattaaggagaagagttggcgaataagtgcaagcgaagctctcaag
cacccctggttgtcagaccacaagctccactccagactcaatgcccagaagaagaagaag
aagaatcgtggctctgatgtccaggacttgtga

KEGG   Macaca mulatta (rhesus monkey): 712830
Entry
712830            CDS       T01028                                 

Gene name
MYLK2
Definition
(RefSeq) myosin light chain kinase 2, skeletal/cardiac muscle
  KO
K00907  myosin-light-chain kinase [EC:2.7.11.18]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04020  Calcium signaling pathway
mcc04022  cGMP-PKG signaling pathway
mcc04270  Vascular smooth muscle contraction
mcc04371  Apelin signaling pathway
mcc04510  Focal adhesion
mcc04611  Platelet activation
mcc04810  Regulation of actin cytoskeleton
mcc04921  Oxytocin signaling pathway
mcc04971  Gastric acid secretion
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    712830 (MYLK2)
   04020 Calcium signaling pathway
    712830 (MYLK2)
   04022 cGMP-PKG signaling pathway
    712830 (MYLK2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    712830 (MYLK2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    712830 (MYLK2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    712830 (MYLK2)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    712830 (MYLK2)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    712830 (MYLK2)
  09154 Digestive system
   04971 Gastric acid secretion
    712830 (MYLK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcc01001]
    712830 (MYLK2)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.18  myosin-light-chain kinase
     712830 (MYLK2)
Protein kinases [BR:mcc01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   712830 (MYLK2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo APH
Other DBs
NCBI-GeneID: 712830
NCBI-ProteinID: XP_028684125
Ensembl: ENSMMUG00000000968
LinkDB
Position
10
AA seq 595 aa
MATENGAVELGIQNPSTDKAPKGPAGEGPLGTGKDPGPPDPKKTPDPPTLKKDAKAPAPE
KGDGTLAQPSTSSQGPEGEGDRGGGPAEGSAGPPAALPQQTATPETSVKKPKAEEGASGS
QDPGEPRVGKKAAEGQAAARRGSPAFLHSPSCPAIISSSEKLLAKKPLSEASELTFEGVP
MTHGPTDPRPAKAEGKSILAESQKEVGEKTPGQAGQAEVQGDTSRGIEFQAVPSEKSEVG
QALCLTAREEDCFQILDDCPPPPAPFPHRMVELRTGNVSSEFSMNSKEALGGGKFGAVCT
CKEKATGLKLAAKVIKKQTPKDKEMVLLEIEVMNQLNHRNLIQLYAAIETPHEIVLFMEY
IEGGELFERIVDEDYHLTEVDTMVFVRQICDGILFMHKMRVLHLDLKPENILCVNTTGHL
VKIIDFGLARRYNPNEKLKVNFGTPEFLSPEVVNYDQISDKTDMWSMGVITYMLLSGLSP
FLGDDDTETLNNVLSGNWYFDEETFEAVSDEAKDFVSNLIVKDQRARMSAAQCLAHPWLN
NLAEKAKRCNRRLKSQILLKKYLMKRRWKKNFIAVSAANRFKKISSSGALMALGV
NT seq 1788 nt   +upstreamnt  +downstreamnt
atggcgacagaaaatggagcagttgagctgggaattcagaacccgtcaacagacaaggca
cctaaaggtcctgcaggtgaaggacccctgggtacagggaaagaccctggccctccagac
ccaaagaaaactcccgatccacccaccctgaagaaagatgccaaagcccctgccccagag
aaaggggatggtaccctggcccaaccctcaactagcagccaaggccccgagggagagggt
gacaggggcggggggcctgcggagggcagtgctgggcccccggcagccctgccccagcag
actgcaacgccagagaccagtgtcaagaagcccaaggctgaagagggagcctcaggcagc
caggatcctggagagcccagggtgggcaagaaggcagcagagggccaagcagcagccagg
aggggctcacccgcctttctgcatagccccagctgtcccgccatcatctccagttctgag
aagctgctggccaagaagcccctaagtgaggcatcagagctcacctttgaaggggtgccc
atgacccatggccccacagatcccaggccagccaaggcagaaggaaagagcatcctggca
gagagccagaaggaagtgggagagaaaaccccaggccaggctggccaggctgaggtgcaa
ggggacacctcaagagggatcgagttccaggctgttccctcagagaaatccgaggtgggg
caggccctctgtctcacagccagggaggaggactgcttccagattttggatgattgcccg
ccacccccggcccccttccctcaccgcatggtggagctgaggaccggaaatgtcagcagt
gaattcagtatgaactccaaggaggcgctcggaggtggcaagtttggggcagtctgtacc
tgcaaggagaaagccacaggcctcaagctggcagccaaggtcatcaagaaacagactccc
aaagacaaggaaatggtgttgctggagatcgaggtcatgaaccagctgaaccaccgcaat
ctgatccagctgtacgcagccatcgagactccgcatgagatcgtcctgttcatggagtac
atcgagggcggagagctcttcgagaggattgtggatgaggactaccatctgaccgaggtg
gacaccatggtgtttgtcaggcagatttgtgacgggatcctcttcatgcacaagatgagg
gttttgcatctggacctcaagccagagaacatcctgtgtgtcaacaccacggggcatttg
gtgaagatcattgacttcggcctggcacggaggtataaccccaacgagaagctgaaggtg
aactttgggaccccagagttcctgtcacctgaggtggtgaattatgaccaaatctccgat
aagacagacatgtggagtatgggggtgatcacctacatgctgctgagcggcctctccccc
ttcctgggagatgatgacacagagaccctaaacaacgttctatctggcaactggtacttt
gacgaagagacctttgaggccgtatcagatgaggccaaagactttgtctccaacctcatc
gtcaaggaccagagggcccggatgagcgcagcccagtgtctcgcccacccctggctcaac
aacctggcagagaaagccaagcgctgtaaccgacgccttaagtcccagatcttgcttaag
aaatacctcatgaagaggcgctggaagaaaaacttcattgctgtcagcgctgccaaccgc
ttcaagaagatcagcagctcaggggcactgatggctctgggggtctga

KEGG   Macaca mulatta (rhesus monkey): 715422
Entry
715422            CDS       T01028                                 

Gene name
MYLK
Definition
(RefSeq) myosin light chain kinase, smooth muscle isoform X1
  KO
K00907  myosin-light-chain kinase [EC:2.7.11.18]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04020  Calcium signaling pathway
mcc04022  cGMP-PKG signaling pathway
mcc04270  Vascular smooth muscle contraction
mcc04371  Apelin signaling pathway
mcc04510  Focal adhesion
mcc04611  Platelet activation
mcc04810  Regulation of actin cytoskeleton
mcc04921  Oxytocin signaling pathway
mcc04971  Gastric acid secretion
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    715422 (MYLK)
   04020 Calcium signaling pathway
    715422 (MYLK)
   04022 cGMP-PKG signaling pathway
    715422 (MYLK)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    715422 (MYLK)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    715422 (MYLK)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    715422 (MYLK)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    715422 (MYLK)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    715422 (MYLK)
  09154 Digestive system
   04971 Gastric acid secretion
    715422 (MYLK)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcc01001]
    715422 (MYLK)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.18  myosin-light-chain kinase
     715422 (MYLK)
Protein kinases [BR:mcc01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   715422 (MYLK)
SSDB
Motif
Pfam: I-set Ig_3 ig Ig_2 Pkinase 23ISL V-set PK_Tyr_Ser-Thr C2-set_2 fn3 Ig_4 Ig_6 Herpes_gE Kinase-like Invasin_D3 Kdo AvrM_N
Other DBs
NCBI-GeneID: 715422
NCBI-ProteinID: XP_001113525
Ensembl: ENSMMUG00000014818
LinkDB
Position
2
AA seq 1914 aa
MGDVKLVASSHISKTSLSVAPSRVGSMPLTEAPAFILPPRNLCIKEGATAKFEGRVRGYP
EPQVTWHRNGQPITSGGRFLLDCGIRGTFSLVIHAVHEEDRGKYTCEATNGSGARQVTVE
LTVEGSFAKQLGQPVVSKTLGDRFSASAVETRPSIWGECPPKFATKLGRVVVKEGQMGRF
SCKITGRPQPQVTWLKGNVPLQPSARVSMSEKNGMQVLEIHGVNQDDMGVYTCLVVNGSG
KASMSAELSIQGLDSANRSFGRETKATNSYVRREVTNVISKELKLNSLEAAAESKNCCSP
QRGGSPAWAANSQPQPPRESKLESCKDSPRTAPQTPVLQTTSSSITLQAARVQLEPRAPG
LGALSPSGEERKRPAAPRPATFPTRQPGLGSQDVVSKAATRIIPMEGQKDSALPKFESKP
QSQEVRENQTVKFRCEVSGIPKPEVAWFLEGTPVRRQEGSIEVYEDAGSHYLCLLRARTR
DSGTYSCTASNARGQVSCSWTLQVERLAVMEVAPSFSSVLKDCTVIEGQDFVLQCSVRGT
PVPQITWLLNGQPIQYAHSTCEAGVAELHIQDALPEDHGTYTCLAENALGQVSCSARVTV
HEKKSSGKSEYLLPVAPSKPTAPIFLQGLSDLKVMDGSQVTMTVQVSGNPPPEVIWLHNG
NEIQESEDFHFEQRGTQHSLCIQEVFPEDTGTYTCEAWNSAGEVRTQAVLTVQEPHDGTQ
PWFISKPRSVTASLGQSVLISCAIAGDPFPTVHWLRDGKALSKDTGHYEVLQNEDVFTLV
LKKVQPWHAGRYEILLKNRVGECSCQVSLMLQNSPAGALPRGREPASCEGLCGGGVGADG
GGSDRYGTLRPGWPARGQGWPEEEDGEDVRGVLKRRVETRQHTEEAIRQQEVEQLDFRDL
LGKKVSTKTLSEDDLKEIPAEQMDFRANLQRQVKPKTVSEEERKVHSPQQVDFRSVLAKK
GTPKTPVPEKVPPPKPATPDFRSVLGGKKKLPAENGSSSAETLNAKAVESSKPLSNAQPS
GPLKPMGNAKPAETLKPMGNAKPAETLKPMGNTKPAETLKSASKEELKKDVKNDVNCKRG
HAGTTDNEKRSESQGTAPVFKEKLQDVRVAEGEKLLLQCQVSSDPPATVTWTLNGKTLKT
TKFIVLSQEGSLCSVSIEKALPEDRGLYKCVAKNDAGQAECSCQVTVDDAPASENTKAPE
MKSRRPKSSLPPVLGTESDATVKKKPAPKTPPKAAMPPQIIQFPEDQKVRAGESVELFGK
VTGTQPITCTWMKFRKQIQESEHMKVENSENGSKLTILAARQEHCGCYTLLVENKLGSRQ
AQVNLTVVDKPDPPAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKE
LATCRSTSFNVQDLLPDHEYKFRVRAINVYGTSEPSQESELTTVGEKPEEPKDEVEVSDD
DEKEPEVDYRTVTINTEQKVSDVYDIEERLGSGKFGQVFRLVEKKTRKIWAGKFFKAYSA
KEKENIRQEISIMNCLHHPKLVQCVDAFEEKANIVMVLEIVSGGELFERIIDEDFELTER
ECIKYMRQISEGVEYIHKQGIVHLDLKPENIMCVNKTGTRIKLIDFGLARRLENAGSLKV
LFGTPEFVAPEVINYEPIGYATDMWSIGVICYILVSGLSPFMGDNDNETLANVTSATWDF
DDEAFDEISDDAKDFISNLLKKDMKNRLDCTQCLQHPWLMKDTKNMEAKKLSKDRMKKYM
ARRKWQKTGNAVRAIGRLSSMAMISGLSGRKSSTGSPTSPLNAEKLESEEDVSQAFLEAV
AEEKPHVKPYFSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYD
EDGNCSLIISDVCGDDDAKYTCKAVNSLGEATCTAELIVETMEEGEGEGEEEEE
NT seq 5745 nt   +upstreamnt  +downstreamnt
atgggggatgtgaagctggttgcctcgtcacacatttccaaaacctccctcagcgtggct
ccctcaagagttggctccatgcccctgacagaggcccctgctttcattttgccccctcgg
aacctctgcatcaaagaaggagccaccgccaagttcgaagggcgggtccggggttaccca
gagccccaggtgacgtggcacagaaacgggcaacccatcaccagtgggggccgctttctg
ctggactgcggcatccgggggaccttcagcctagtgattcatgctgtccacgaggaggac
aggggaaagtatacctgtgaagccaccaatggcagtggtgctcgccaggtgacagtggag
ttgacagtagaaggaagttttgcaaagcaacttggtcaacctgttgtttccaaaactttg
ggggatagattttcagcttcagcagtggagacccgtcctagcatctggggggagtgccca
ccaaagtttgctaccaagctgggccgagttgtggtcaaagaaggacagatgggacgattc
tcctgcaagatcactggccggccccaaccgcaggtcacctggctcaagggaaatgttcca
ctgcagccgagtgcccgtgtgtctatgtctgagaagaacgggatgcaggttctggaaatc
catggagtcaaccaagatgacatgggagtgtacacgtgcctggtggtgaacgggtcaggc
aaggcctcgatgtcagctgaactttccatccaaggtttggacagtgccaataggtcattt
gggagagaaacaaaagccaccaattcctacgtcaggagggaggtgaccaatgtaatctca
aaggagttgaaactgaacagtctggaggctgcagccgaaagcaagaactgctgcagcccc
cagagaggtggttccccagcctgggctgcaaacagccagcctcagcccccaagggagtcc
aagctggagtcatgcaaggactcgcccagaacggccccgcagaccccggtccttcagacg
acttccagctccatcaccctgcaggccgcaagagttcagctggaaccaagagcaccaggc
ctgggggccctatcgccttctggagaagagaggaagaggccagctgcaccccgtccagcc
accttccccaccaggcagcctggcctggggagccaagacgttgtgagcaaggctgctacc
aggataatccccatggagggccagaaggattcagcactccccaaatttgagagcaagccc
caaagccaggaggtcagggaaaatcaaactgtcaagttcagatgtgaagtttcagggatt
ccaaagcctgaagtggcctggttcctggaaggcacccccgtgaggagacaggagggcagc
attgaggtttatgaagatgctggctcccattacctctgcctgctgagagcccggaccagg
gacagtgggacatacagctgcactgcttccaacgcccgaggccaggtgtcctgtagctgg
accctccaagtggaaaggcttgctgtgatggaggtggccccctccttctccagtgtcctg
aaggactgcactgtcattgagggtcaggattttgtgctgcagtgctccgtacgggggact
ccagtgccccagatcacttggctgctgaatggacagcccatccagtacgctcactccacc
tgcgaggctggcgtggctgagctccacatccaggatgccctgccagaggaccatggcacc
tacacctgcctggctgagaatgccttggggcaggtgtcctgcagcgcccgggtcaccgtc
catgaaaagaagagtagcgggaagagcgagtaccttctgcctgtggcccccagcaagccc
actgcccccatcttcctgcagggcctctctgatctcaaagtcatggatggaagccaggtc
actatgacagtccaagtgtcagggaatccaccccctgaggtcatctggctgcacaatggg
aacgagatccaagagtcagaggacttccactttgaacagagaggcactcagcacagcctt
tgtatccaggaagtgttcccggaggacacgggcacatacacctgcgaggcctggaacagc
gctggagaggtccgcacccaggccgtgctcacggtacaagagcctcacgatggcacccag
ccctggttcatcagtaagcctcgctcggtgacagcctccctgggccagagtgtcctcatc
tcctgcgccatagctggtgacccctttcctactgtgcactggctccgagatggcaaagcc
ctctccaaagacactggccactacgaggtgcttcagaatgaggacgtgttcaccctggtt
ctaaagaaggtgcagccctggcatgccggccggtatgagatcctgctcaagaaccgggtt
ggtgaatgcagttgccaggtgtcactgatgctacagaacagccctgccggagcccttcca
cgggggagggagcctgccagctgtgagggcctctgtggtggaggagttggtgctgatggt
ggtggtagtgaccgctatgggaccctgaggcctggctggccagcaagagggcagggttgg
ccagaggaggaagacggcgaggacgtgcgaggggtgctgaagaggcgcgtggagacgagg
cagcacaccgaggaggcgatccgccagcaggaggtggagcagctggacttccgagacctc
ctggggaagaaggtgagtaccaagaccctatcggaagacgacctgaaggagatcccagcc
gagcagatggatttccgtgccaacctgcagcggcaagtgaagccaaagactgtgtccgag
gaagagaggaaggtgcacagcccccagcaggtcgatttccgctctgtcctggccaagaag
gggactcccaagacccctgtgcctgagaaggtgccaccaccgaaacctgccaccccggat
tttcgctcagtgctcggtggcaagaagaaattaccagcggagaatggtagcagcagtgct
gagaccctgaatgccaaggccgtggaaagttccaagcccctgagcaatgcacagccttca
gggcccttgaaacccatgggcaacgccaagcctgctgagaccctgaagcccatgggcaac
gccaagcctgctgagaccctgaagcccatgggcaacaccaagcctgctgagaccctgaaa
tccgctagcaaagaagaactcaagaaagatgttaagaatgatgtgaattgcaagagaggc
catgcagggaccacagataatgaaaaaagatcagagagccaggggacagccccagtcttc
aaggagaagctgcaagatgttcgtgtggcagagggcgagaagctgctgctccagtgccag
gtgtcttctgaccccccagccaccgtcacctggacactgaatggaaagaccctcaagacc
accaagttcatcgtcctctcccaggaaggctcactctgctccgtctccatcgagaaggca
ctgcctgaggacagaggcttgtacaagtgtgtagccaagaatgatgctggccaggctgag
tgctcctgccaagtcaccgtggacgatgccccggccagtgagaacaccaaggccccagag
atgaaatcccggaggcccaagagctctcttcctcccgtgctaggaactgagagtgatgca
actgtgaaaaagaaacctgcccccaagacacctccgaaggcagcaatgccccctcagatc
atccagttccctgaggaccagaaggtacgcgccggagagtcagtggagctgtttggtaaa
gtgacaggcacccagcccatcacctgtacctggatgaagttccgaaagcagatccaggag
agcgagcacatgaaggtggagaacagcgagaatggcagcaagctcaccatcctggccgca
cgccaggagcactgcggctgctacacactgctggtggagaacaagctgggcagcaggcag
gcccaggtcaacctcactgtcgtggataagccagaccccccagctggcacaccttgtgcc
tctgacattcggagctcctcactgaccctgtcctggtacggctcctcgtacgatgggggc
agtgccgtgcagtcctacagcatcgagatctgggactcagccaacaagacgtggaaggaa
ctagccacatgccgcagcacctctttcaacgttcaggacctgctgcctgaccatgagtat
aagttccgtgtacgtgcaatcaacgtgtatggaaccagtgagccaagccaggagtctgaa
ctcacaacggtaggagagaaacctgaagagccaaaggatgaagtggaggtttcagacgat
gatgagaaggagcctgaggttgattatcggacggtgacaatcaatactgaacaaaaagta
tctgacgtctacgacatcgaagagagattaggatctgggaaatttggacaggtctttcga
cttgtagaaaagaaaactcgaaaaatctgggcagggaaattcttcaaggcatattcagca
aaagagaaagagaatatccggcaggagatcagcatcatgaactgcctccaccaccccaag
ctcgtccagtgtgtggatgccttcgaagaaaaggccaacatcgtcatggtcctggagatc
gtgtcaggaggtgagctgtttgagcgcatcattgacgaggacttcgagctgacggagcgc
gagtgcatcaagtacatgcggcagatctcggagggggtggagtacatccacaagcagggc
atcgtgcacctggacctcaagccggagaacatcatgtgtgtcaacaagacgggcaccagg
atcaagctcatcgactttggtctggccaggaggctggagaatgcggggtccctgaaggtc
ctctttggcaccccggagtttgtggctcctgaagtgatcaactatgagcccatcggctat
gccacagacatgtggagcatcggggtcatctgctacatcctagtcagtggcctttccccc
ttcatgggagacaacgataatgaaaccttggccaacgttacctcagccacctgggatttc
gacgacgaggcattcgatgagatctccgacgatgccaaggatttcatcagcaatctgctg
aagaaagatatgaaaaaccgcctggactgcacacagtgccttcagcatccatggctaatg
aaagataccaagaacatggaggccaagaaactctccaaggaccggatgaagaagtacatg
gcaagaaggaaatggcagaaaacgggcaatgctgtgagagccattggaagactgtcctct
atggcaatgatctcagggctcagtggcaggaaatcctcaacagggtcaccaaccagcccg
ctcaatgcagaaaaactagaatctgaagaagatgtgtcccaagctttccttgaggctgtt
gctgaggaaaagcctcatgtaaaaccctatttctctaagaccattcgtgatttagaagtt
gtggagggaagtgctgctagatttgactgcaagattgaaggatacccggaccccgaggtt
gtctggttcaaagatgaccagtcaatcagggagtcccgccacttccagatagactacgat
gaggacgggaactgctctttaattattagtgatgtttgtggggatgatgatgccaagtac
acctgcaaagctgtcaacagtcttggagaagccacctgcacagcagagctcattgtggaa
acgatggaggaaggtgaaggggaaggggaagaggaagaagagtga

KEGG   Macaca mulatta (rhesus monkey): 716132
Entry
716132            CDS       T01028                                 

Gene name
MYLK3
Definition
(RefSeq) myosin light chain kinase 3 isoform X1
  KO
K00907  myosin-light-chain kinase [EC:2.7.11.18]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04020  Calcium signaling pathway
mcc04022  cGMP-PKG signaling pathway
mcc04270  Vascular smooth muscle contraction
mcc04371  Apelin signaling pathway
mcc04510  Focal adhesion
mcc04611  Platelet activation
mcc04810  Regulation of actin cytoskeleton
mcc04921  Oxytocin signaling pathway
mcc04971  Gastric acid secretion
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    716132 (MYLK3)
   04020 Calcium signaling pathway
    716132 (MYLK3)
   04022 cGMP-PKG signaling pathway
    716132 (MYLK3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    716132 (MYLK3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    716132 (MYLK3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    716132 (MYLK3)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    716132 (MYLK3)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    716132 (MYLK3)
  09154 Digestive system
   04971 Gastric acid secretion
    716132 (MYLK3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcc01001]
    716132 (MYLK3)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.18  myosin-light-chain kinase
     716132 (MYLK3)
Protein kinases [BR:mcc01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   716132 (MYLK3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Kdo XhlA APH
Other DBs
NCBI-GeneID: 716132
NCBI-ProteinID: XP_001113601
Ensembl: ENSMMUG00000019786
UniProt: F7G5G3
LinkDB
Position
20
AA seq 819 aa
MSGTSKESLGHWGLPGLGKACLTTMDKKLNMLNEKVDQLLHFQEDVTEKLQSVCRDMGHL
EQGLRRLEASRAPGPGGADGVPRADTQAGWPEVLELVRAMQQDAAQHGARLEALFRMVAA
VDRAIALVGATLQKSKVADFLMQGHVPWRGGSPGDSPEENKERVEEEGAKPKHVLSASGV
QSDAREPGEESQKVDVLEGTVERLPPIRASGLGADPAQAWASPGQGDGVPGPAQAFPGHL
PLPTKVEAKPPETPSESPRTGLELAPAPGRVNVVSPSLEVAPGAGQGASSSRPDPWPLEE
GTRLTPGPGPQCPGPPGLPSQARAAHSGGKTPPRISIHMQEMDTPGEMLVTRRGSLGPSP
ATEAPAAAQPGEQGPPGTGRCLQAPGTEPREQTPEGARELSPLQESSSPRGAKSEEDQRA
GVEPSTRPSLARRDDDDHAVGALGLQQGKGPGAGNPEPEQDCAARAPGRAEAVRRMPPGV
EAGSVVLDDSPAPPAPFEHRVVSVKETSISADYEVCQHEVLGGGRFGQVHRCTEKSTGLP
LAAKIIKVKSAKDREDVKNEINIMNQLSHVNLIQLYDAFESKHSCTLVMEYVDGGELFDR
ITDEKYHLTELDVVLFTRQICEGVHYLHQHYILHLDLKPENILCVNQTGHQIKIIDFGLA
RRYKPREKLKVNFGTPEFLAPEVVNYEFVSFPTDMWSVGVITYMLLSGLSPFLGETDAET
MNFIVNCSWDFDADTFEGLSEEAKDFVSRLLVKEKSCRMSATQCLKHEWLNNLPAKASRS
KTRLKSQLLLQKYIAQRKWKKHFYVVTAANRLRKFPTSP
NT seq 2460 nt   +upstreamnt  +downstreamnt
atgtcaggaacctccaaggagagtctggggcactgggggctaccagggttgggcaaggcc
tgcttaaccaccatggacaaaaagctgaacatgctgaacgagaaggtggaccagctcctt
cacttccaagaagatgtcacagagaagttgcagagcgtgtgccgagacatgggccacctg
gagcagggcctgcgcaggctggaggcctcccgggcaccaggcccaggcggggctgatggg
gttccccgcgctgacacccaggccgggtggcccgaggtcctggagctggtgagggccatg
cagcaggatgcggcccagcacggtgccaggctggaggccctcttcaggatggtggctgcg
gtggacagggccatcgctttggtgggggccacattgcagaaatcgaaggtggcggatttc
ctcatgcaagggcatgtcccctggaggggaggcagcccaggtgacagccccgaggagaac
aaagagcgagtggaagaagaaggagcaaaaccaaagcatgtgctgagcgccagtggggtg
cagtctgatgccagggagcctggggaagagagccagaaggtggacgtgctggaggggaca
gtggagaggctgccccccatcagagcttcggggctgggagctgaccccgcccaagcatgg
gcctcaccaggccagggagatggtgttcctggcccagcccaggcattccctggccacctg
cccctgcccacaaaggtggaagccaagcctcctgagacacccagcgagagccccaggact
ggcctggaattggctccagcacccggcagggtcaatgtggtctccccgagcctggaggtt
gcaccaggtgcaggacaaggagcgtcatccagcaggcctgacccttggcccttagaggaa
ggcacgaggttgactccagggcctggcccccagtgcccagggcctccagggctgccatcc
caggccagggcagcccacagtggtggaaaaacacctccaaggatctccatccacatgcaa
gagatggatactcctggggagatgctggtgacacgcaggggcagccttggacccagccct
gccacagaggctccagcagctgcccagccaggcgagcagggcccacctgggactgggcgc
tgcctccaagcccctgggacggagcccagagaacagactcctgaaggagccagagagctc
tccccactgcaggagagcagcagccccaggggggcgaagtcagaggaggatcaaagggct
ggggttgagcctagcacgagaccaagcttggccaggagggacgacgatgaccacgcagtt
ggggccctgggcctgcagcagggcaaaggcccaggagcaggaaaccctgagcctgagcag
gactgtgcagccagggctccagggagagccgaagcagtaaggaggatgcccccaggcgtc
gaggctggcagcgtggttctggatgacagtccggccccgccagctccttttgaacaccgg
gtagtaagcgtcaaggagacctccatctcggcagattacgaggtgtgccagcacgaagtc
ttgggagggggccggtttggccaggtccacaggtgcacagagaagtccacaggcctccca
ctggctgccaagatcatcaaagtgaagagcgccaaggaccgggaggatgtgaagaacgag
atcaacatcatgaaccagcttagccacgtgaacctgatccagctctatgatgccttcgag
agcaagcacagctgcaccctcgtcatggagtacgtggacgggggtgagctcttcgaccgg
atcacagatgagaagtaccacctgaccgaactggatgtggtcctgttcaccaggcagatc
tgtgagggcgtgcattacctgcaccagcactacatcctgcacctggacctcaagccggag
aacatattgtgcgtcaatcagacaggacatcaaattaagatcattgacttcgggctggcc
agaaggtacaagcctcgagagaagctgaaggtgaacttcggcactcctgagttcctggcc
ccagaagtcgtcaactatgagtttgtctcattccccacggacatgtggagtgtgggagtc
atcacctacatgctactcagtggcttgtccccatttctaggggaaacagatgcagagacc
atgaatttcattgtaaactgtagctgggattttgatgctgacacctttgaagggctctcg
gaggaggccaaggactttgtttcccggttgctagtcaaagagaagagctgcagaatgagt
gccacacagtgcctgaaacacgagtggctgaataatttgcctgccaaagcttcaagatcc
aaaactcgtctcaaatcccaactactgctgcagaaatacatagctcaaagaaaatggaag
aaacatttctatgtggtgactgctgccaacaggttaaggaaatttccgacttctccctaa

DBGET integrated database retrieval system