KEGG   Macaca mulatta (rhesus monkey): 707407
Entry
707407            CDS       T01028                                 

Gene name
BCL2
Definition
(RefSeq) apoptosis regulator Bcl-2
  KO
K02161  apoptosis regulator Bcl-2
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc01521  EGFR tyrosine kinase inhibitor resistance
mcc01522  Endocrine resistance
mcc01524  Platinum drug resistance
mcc04064  NF-kappa B signaling pathway
mcc04066  HIF-1 signaling pathway
mcc04071  Sphingolipid signaling pathway
mcc04115  p53 signaling pathway
mcc04140  Autophagy - animal
mcc04141  Protein processing in endoplasmic reticulum
mcc04151  PI3K-Akt signaling pathway
mcc04210  Apoptosis
mcc04215  Apoptosis - multiple species
mcc04217  Necroptosis
mcc04261  Adrenergic signaling in cardiomyocytes
mcc04340  Hedgehog signaling pathway
mcc04510  Focal adhesion
mcc04621  NOD-like receptor signaling pathway
mcc04630  JAK-STAT signaling pathway
mcc04722  Neurotrophin signaling pathway
mcc04725  Cholinergic synapse
mcc04915  Estrogen signaling pathway
mcc04928  Parathyroid hormone synthesis, secretion and action
mcc04933  AGE-RAGE signaling pathway in diabetic complications
mcc05014  Amyotrophic lateral sclerosis
mcc05022  Pathways of neurodegeneration - multiple diseases
mcc05132  Salmonella infection
mcc05145  Toxoplasmosis
mcc05152  Tuberculosis
mcc05161  Hepatitis B
mcc05162  Measles
mcc05168  Herpes simplex virus 1 infection
mcc05169  Epstein-Barr virus infection
mcc05170  Human immunodeficiency virus 1 infection
mcc05200  Pathways in cancer
mcc05206  MicroRNAs in cancer
mcc05210  Colorectal cancer
mcc05215  Prostate cancer
mcc05222  Small cell lung cancer
mcc05226  Gastric cancer
mcc05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    707407 (BCL2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    707407 (BCL2)
   04630 JAK-STAT signaling pathway
    707407 (BCL2)
   04064 NF-kappa B signaling pathway
    707407 (BCL2)
   04066 HIF-1 signaling pathway
    707407 (BCL2)
   04071 Sphingolipid signaling pathway
    707407 (BCL2)
   04151 PI3K-Akt signaling pathway
    707407 (BCL2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    707407 (BCL2)
  09143 Cell growth and death
   04210 Apoptosis
    707407 (BCL2)
   04215 Apoptosis - multiple species
    707407 (BCL2)
   04217 Necroptosis
    707407 (BCL2)
   04115 p53 signaling pathway
    707407 (BCL2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    707407 (BCL2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    707407 (BCL2)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    707407 (BCL2)
   04928 Parathyroid hormone synthesis, secretion and action
    707407 (BCL2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    707407 (BCL2)
  09156 Nervous system
   04725 Cholinergic synapse
    707407 (BCL2)
   04722 Neurotrophin signaling pathway
    707407 (BCL2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    707407 (BCL2)
   05206 MicroRNAs in cancer
    707407 (BCL2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    707407 (BCL2)
   05226 Gastric cancer
    707407 (BCL2)
   05215 Prostate cancer
    707407 (BCL2)
   05222 Small cell lung cancer
    707407 (BCL2)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    707407 (BCL2)
   05022 Pathways of neurodegeneration - multiple diseases
    707407 (BCL2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    707407 (BCL2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    707407 (BCL2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    707407 (BCL2)
   05152 Tuberculosis
    707407 (BCL2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    707407 (BCL2)
   05161 Hepatitis B
    707407 (BCL2)
   05162 Measles
    707407 (BCL2)
   05168 Herpes simplex virus 1 infection
    707407 (BCL2)
   05169 Epstein-Barr virus infection
    707407 (BCL2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    707407 (BCL2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    707407 (BCL2)
   01524 Platinum drug resistance
    707407 (BCL2)
   01522 Endocrine resistance
    707407 (BCL2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mcc01009]
    707407 (BCL2)
Protein phosphatases and associated proteins [BR:mcc01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     707407 (BCL2)
SSDB
Motif
Pfam: Bcl-2 BH4 Bcl-2_3
Other DBs
NCBI-GeneID: 707407
NCBI-ProteinID: XP_028693883
Ensembl: ENSMMUG00000037487
LinkDB
Position
18
AA seq 241 aa
MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAATPGAAPAPGIFSSQPGHTPHPA
ASRDPVARTSPLPTPAAPAAAAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQ
LHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMT
EYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGH
K
NT seq 726 nt   +upstreamnt  +downstreamnt
atggcgcacgctgggagaacagggtacgataaccgggagatagtgatgaagtacatccac
tataagctgtcgcagaggggctacgagtgggatgcgggggatgtgggcgcggcgacccct
ggggccgcccccgcaccgggcatcttctcctcccagcccgggcacacgccccatcccgcc
gcgtcccgggacccggtcgccaggacctcgccgctgccgaccccggctgcccccgccgcc
gccgccgccgcggggcctgcgctcagcccggtgccacctgtggtccacctgaccctccgc
caggccggtgacgacttctcccgccgctaccgccgcgacttcgccgagatgtccagccag
ctgcacctgacgcccttcaccgcgcggggacgctttgccacggtggtggaggagctcttc
agggacggggtgaactgggggaggatcgtggccttctttgagttcggtggggtcatgtgt
gtggagagcgtcaaccgggagatgtcgcccctggtggacaacatcgccctgtggatgact
gagtacctgaaccggcacctgcacacctggatccaggataacggaggctgggacgccttt
gtggaactgtacggccccagcatgcggcctctgtttgatttctcctggctgtctctgaag
actctgctcagtttggccctggtgggagcttgcatcaccctgggtgcctatctgggccac
aagtga

DBGET integrated database retrieval system