Macaca mulatta (rhesus monkey): 707407 Help Entry 707407            CDS       T01028                                  Gene name BCL2 Definition (RefSeq) apoptosis regulator Bcl-2   KO K02161   apoptosis regulator Bcl-2 Organism mcc  Macaca mulatta (rhesus monkey) Pathway mcc01521   EGFR tyrosine kinase inhibitor resistance mcc01522   Endocrine resistance mcc01524   Platinum drug resistance mcc04064   NF-kappa B signaling pathway mcc04066   HIF-1 signaling pathway mcc04071   Sphingolipid signaling pathway mcc04115   p53 signaling pathway mcc04140   Autophagy - animal mcc04141   Protein processing in endoplasmic reticulum mcc04151   PI3K-Akt signaling pathway mcc04210   Apoptosis mcc04215   Apoptosis - multiple species mcc04217   Necroptosis mcc04261   Adrenergic signaling in cardiomyocytes mcc04340   Hedgehog signaling pathway mcc04510   Focal adhesion mcc04621   NOD-like receptor signaling pathway mcc04630   JAK-STAT signaling pathway mcc04722   Neurotrophin signaling pathway mcc04725   Cholinergic synapse mcc04915   Estrogen signaling pathway mcc04928   Parathyroid hormone synthesis, secretion and action mcc04933   AGE-RAGE signaling pathway in diabetic complications mcc05014   Amyotrophic lateral sclerosis mcc05022   Pathways of neurodegeneration - multiple diseases mcc05132   Salmonella infection mcc05145   Toxoplasmosis mcc05152   Tuberculosis mcc05161   Hepatitis B mcc05162   Measles mcc05168   Herpes simplex virus 1 infection mcc05169   Epstein-Barr virus infection mcc05170   Human immunodeficiency virus 1 infection mcc05200   Pathways in cancer mcc05206   MicroRNAs in cancer mcc05210   Colorectal cancer mcc05215   Prostate cancer mcc05222   Small cell lung cancer mcc05226   Gastric cancer mcc05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:mcc00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     707407 (BCL2)  09130 Environmental Information Processing   09132 Signal transduction    04340 Hedgehog signaling pathway     707407 (BCL2)    04630 JAK-STAT signaling pathway     707407 (BCL2)    04064 NF-kappa B signaling pathway     707407 (BCL2)    04066 HIF-1 signaling pathway     707407 (BCL2)    04071 Sphingolipid signaling pathway     707407 (BCL2)    04151 PI3K-Akt signaling pathway     707407 (BCL2)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     707407 (BCL2)   09143 Cell growth and death    04210 Apoptosis     707407 (BCL2)    04215 Apoptosis - multiple species     707407 (BCL2)    04217 Necroptosis     707407 (BCL2)    04115 p53 signaling pathway     707407 (BCL2)   09144 Cellular community - eukaryotes    04510 Focal adhesion     707407 (BCL2)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     707407 (BCL2)   09152 Endocrine system    04915 Estrogen signaling pathway     707407 (BCL2)    04928 Parathyroid hormone synthesis, secretion and action     707407 (BCL2)   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     707407 (BCL2)   09156 Nervous system    04725 Cholinergic synapse     707407 (BCL2)    04722 Neurotrophin signaling pathway     707407 (BCL2)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     707407 (BCL2)    05206 MicroRNAs in cancer     707407 (BCL2)   09162 Cancer: specific types    05210 Colorectal cancer     707407 (BCL2)    05226 Gastric cancer     707407 (BCL2)    05215 Prostate cancer     707407 (BCL2)    05222 Small cell lung cancer     707407 (BCL2)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     707407 (BCL2)    05022 Pathways of neurodegeneration - multiple diseases     707407 (BCL2)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     707407 (BCL2)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     707407 (BCL2)   09171 Infectious disease: bacterial    05132 Salmonella infection     707407 (BCL2)    05152 Tuberculosis     707407 (BCL2)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     707407 (BCL2)    05161 Hepatitis B     707407 (BCL2)    05162 Measles     707407 (BCL2)    05168 Herpes simplex virus 1 infection     707407 (BCL2)    05169 Epstein-Barr virus infection     707407 (BCL2)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     707407 (BCL2)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     707407 (BCL2)    01524 Platinum drug resistance     707407 (BCL2)    01522 Endocrine resistance     707407 (BCL2)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:mcc01009]     707407 (BCL2) Protein phosphatases and associated proteins [BR:mcc01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Protein phosphatase-1     PP1-interacting proteins (PIPs)      707407 (BCL2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Bcl-2 BH4 Bcl-2_3 Motif Other DBs NCBI-GeneID:  707407 NCBI-ProteinID:  XP_028693883 Ensembl:  ENSMMUG00000037487 LinkDB All DBs Position 18 AA seq 241 aa AA seqDB search MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAATPGAAPAPGIFSSQPGHTPHPA ASRDPVARTSPLPTPAAPAAAAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQ LHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMT EYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGH K NT seq 726 nt NT seq  +upstreamnt  +downstreamnt atggcgcacgctgggagaacagggtacgataaccgggagatagtgatgaagtacatccac tataagctgtcgcagaggggctacgagtgggatgcgggggatgtgggcgcggcgacccct ggggccgcccccgcaccgggcatcttctcctcccagcccgggcacacgccccatcccgcc gcgtcccgggacccggtcgccaggacctcgccgctgccgaccccggctgcccccgccgcc gccgccgccgcggggcctgcgctcagcccggtgccacctgtggtccacctgaccctccgc caggccggtgacgacttctcccgccgctaccgccgcgacttcgccgagatgtccagccag ctgcacctgacgcccttcaccgcgcggggacgctttgccacggtggtggaggagctcttc agggacggggtgaactgggggaggatcgtggccttctttgagttcggtggggtcatgtgt gtggagagcgtcaaccgggagatgtcgcccctggtggacaacatcgccctgtggatgact gagtacctgaaccggcacctgcacacctggatccaggataacggaggctgggacgccttt gtggaactgtacggccccagcatgcggcctctgtttgatttctcctggctgtctctgaag actctgctcagtttggccctggtgggagcttgcatcaccctgggtgcctatctgggccac aagtga

DBGET integrated database retrieval system