KEGG   Macaca mulatta (rhesus monkey): 707466
Entry
707466            CDS       T01028                                 

Gene name
KNG1
Definition
(RefSeq) kininogen-1
  KO
K03898  kininogen
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04022  cGMP-PKG signaling pathway
mcc04071  Sphingolipid signaling pathway
mcc04080  Neuroactive ligand-receptor interaction
mcc04610  Complement and coagulation cascades
mcc04750  Inflammatory mediator regulation of TRP channels
mcc04810  Regulation of actin cytoskeleton
mcc05142  Chagas disease
mcc05143  African trypanosomiasis
mcc05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    707466 (KNG1)
   04022 cGMP-PKG signaling pathway
    707466 (KNG1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    707466 (KNG1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    707466 (KNG1)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    707466 (KNG1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    707466 (KNG1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    707466 (KNG1)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    707466 (KNG1)
   05143 African trypanosomiasis
    707466 (KNG1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mcc01002]
    707466 (KNG1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcc04147]
    707466 (KNG1)
Peptidases and inhibitors [BR:mcc01002]
 Peptidase inhibitors
  Family I25: cystatin family
   707466 (KNG1)
Exosome [BR:mcc04147]
 Exosomal proteins
  Exosomal proteins of hepatic cells
   707466 (KNG1)
  Exosomal proteins of other cancer cells
   707466 (KNG1)
SSDB
Motif
Pfam: Cystatin Cathelicidins Spp-24 Bradykinin
Other DBs
NCBI-GeneID: 707466
NCBI-ProteinID: XP_014987926
Ensembl: ENSMMUG00000003700
UniProt: G7MK69
LinkDB
Position
2
AA seq 644 aa
MKLIIILFFCSRLLLSLTQESQSEEIDCNDKDLFKAVDAALKKYNSQNQSNNQFVLYRIT
EATKMVRSDTFYSFKYEIKEGDCPVQSGKTWQDCDYKDAAEAATGECTATVGKRASMKFS
VATQTCQITPAEGPVVTAQYNCLGCVHPISTQSPDLEPILRHGVQYFNNNTQHSSLFTLS
EVKRAQRQVVAGWNFLITYSIVQTNCSKENFLFLTPDCKSLWNGDTGECTDNAYVDTQLQ
IASFSQKCDIYPGEDFVQPPSKICVGCPRDIPTNSPELEETLTHTITKLNAENNATFYFK
IDNVKKARVQVVAGKKYFIDFVARETTCSKESNEELTESCETKKLGQSLDCNAEVYVVPW
EKKIYPTVNCQPLGMISLMKRPPGFSPFRSTQVGEIKEETTVSPPHTSMAPAQDEERESG
KEQGRTHRHDWGHEKQRKCNLGHGHKHECDQGHGHQRGHGLGRGHQQQHGLGHGHKFKLD
DDLEHQGGHVLDHGHKHKHGHGHGKHKNKGKKNGKHNGWKTEHLASSSEDSTTPSAQIQE
KTEGPTPIPSLAQPGVADTFSDFQDSDLIVTMMPPILPTPTESDDDWIPDIQIEPNGLSF
NPISDFPDTTSPKCPGRPWKSVSENNPTTKMKESYDFNLADALY
NT seq 1935 nt   +upstreamnt  +downstreamnt
atgaaactaattatcatccttttcttctgctccaggctgctactaagtttaacccaggaa
tcacagtccgaggaaattgactgcaatgataaggatttatttaaagctgtggatgctgct
ctgaagaaatataacagtcaaaaccaaagtaacaaccagttcgtactgtaccgcataact
gaagccactaagatggttcgctctgacacattttattccttcaagtacgaaatcaaggag
ggggattgtcctgttcaaagtggcaaaacctggcaggactgtgactacaaggatgctgca
gaagcggccactggagaatgcacggcaaccgtggggaagagggcgagtatgaaattctct
gtggctacccagacctgccagattactccagccgagggccctgtggtgacagcccagtat
aactgccttggctgtgtgcatcctatatcaacgcagagcccagacctggagcccattctg
agacacggcgttcagtactttaacaacaatactcaacattcctccctcttcacgcttagt
gaagtaaaacgggcccaaagacaggtggtggctggatggaactttctaattacctactca
attgtgcaaacgaattgttccaaagagaattttctgttcttaactccagactgcaagtcc
ctttggaatggtgataccggtgaatgtacagataatgcatacgtcgatactcagctacaa
attgcttccttctcacagaagtgtgacatttatccaggggaggattttgtacaaccacct
tccaagatttgcgtgggctgccccagagatatacccaccaacagcccagagctggaggag
acactgactcacaccatcacaaagcttaatgcggagaataacgcaactttctatttcaag
attgacaatgtgaaaaaagcaagagtacaggtggtggctggcaagaaatattttattgac
tttgtggccagggaaaccacatgttccaaggaaagtaatgaagagttgaccgaaagctgt
gagaccaaaaaacttggtcaaagcctagattgcaatgctgaagtttatgtggtaccctgg
gagaagaaaatttaccctactgtcaactgtcaaccactgggaatgatctcattgatgaaa
aggcctccaggtttttcacctttccgatcaacacaagtaggggaaataaaagaagaaaca
actgtaagtccaccccacacttccatggcacctgcacaagatgaagagcgggagtcagga
aaagaacaagggcgtactcatagacatgactggggccatgaaaaacaaagaaaatgtaat
ctcggccatggccataaacatgaatgtgaccaagggcatgggcatcaaaggggacatggc
ctcggccgtggacaccaacaacagcatggtcttggtcatggacataagttcaaacttgat
gatgatcttgaacaccaagggggccatgtccttgaccatggacataagcataagcatggt
catggccatggaaaacataaaaataaaggcaaaaagaatggaaagcacaatggttggaaa
acagagcatttggcaagctcttctgaagacagtactacaccttctgcacagatacaagag
aagacagaagggccaacacccatcccttccctagcccagccaggtgtagcagataccttt
tctgactttcaggactctgatctcattgtaactatgatgcctcctatactaccaactccc
acagagagtgatgacgattggatccctgacatccagatagaaccaaatgggctttcattt
aacccaatatcagattttccagacacaacctcccccaaatgtcctggacgcccctggaag
tcagttagtgaaaataacccaaccacaaaaatgaaagaatcttatgatttcaatcttgct
gatgccctttattaa

DBGET integrated database retrieval system