KEGG   Macaca mulatta (rhesus monkey): 707555
Entry
707555            CDS       T01028                                 

Definition
(RefSeq) tyrosine-protein kinase ZAP-70 isoform X1
  KO
K07360  tyrosine-protein kinase ZAP-70 [EC:2.7.10.2]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04014  Ras signaling pathway
mcc04064  NF-kappa B signaling pathway
mcc04650  Natural killer cell mediated cytotoxicity
mcc04658  Th1 and Th2 cell differentiation
mcc04659  Th17 cell differentiation
mcc04660  T cell receptor signaling pathway
mcc05135  Yersinia infection
mcc05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mcc05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    707555
   04064 NF-kappa B signaling pathway
    707555
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    707555
   04660 T cell receptor signaling pathway
    707555
   04658 Th1 and Th2 cell differentiation
    707555
   04659 Th17 cell differentiation
    707555
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    707555
  09163 Immune disease
   05340 Primary immunodeficiency
    707555
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    707555
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcc01001]
    707555
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     707555
Protein kinases [BR:mcc01001]
 Non-receptor tyrosine kinases
  SYK family
   707555
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase SH2 Kdo
Other DBs
NCBI-GeneID: 707555
NCBI-ProteinID: XP_014968406
Ensembl: ENSMMUG00000021545
UniProt: F7FAI7
LinkDB
Position
13
AA seq 619 aa
MPDPAAHLPFFYGSISRSEAEEHLKLAGMADGLFLLRQCLRSLGGYVLSLVHDVRFHHFP
IERQLNGTYAIAGGKAHCGPAELCEFYSRDPDGLPCNLRKPCNRPSGLEPQPGVFDCLRD
AMVRDYVRQTWKLEGEALEQAIISQAPQVEKLIATTAHERMPWYHSSLTREEAERKLYSG
TQTDGKFLLRPRKEQGTYALSLIYGKTVYHYLISQDKAGKYCIPEGTKFDTLWQLVEYLK
LKADGLIYCLKEACPNSSASSASGAAAPTLPAHPSTFTHPQRRIDTLNSDGYTPEPARVT
SPEKPRPMPMDTSVYESPYSDPEELKDKKLFLKRDNLLIADIELGCGNFGSVRQGVYRMR
KKQIDVAIKVLKQGTEKADTEEMMREAQIMHQLDNPYIVRLIGVCQAEALMLVMEMAGSG
PLHKFLAGKKEEIPVSNVAELLHQVSMGMKYLEEKNFVHRDLAARNVLLVNRHYAKISDF
GLSKALGADDSYYTARSAGKWPLKWYAPECINFRKFSSRSDVWSYGVTMWEALSYGQKPY
KKMKGPEVMAFIEQGKRMECPSECPPELYELMSDCWIYKWEDRPDFLTVEQRMRACYYSL
ASKAEGSPGCAQKAEAACA
NT seq 1860 nt   +upstreamnt  +downstreamnt
atgccagaccccgcggcgcacctgcccttcttctacggcagcatctcgcgctccgaggcc
gaggagcacctgaagctggcgggcatggcggacgggctcttcctgctgcgccagtgcctg
cgctcgctgggcggctatgtgctgtcgctcgtgcacgacgtgcgcttccaccactttccc
atcgagcgccagctcaacggcacctacgccatcgcgggcggcaaggctcactgcggaccg
gccgagctctgcgagttctactcgcgcgaccccgacgggctgccctgcaacctgcgtaag
ccgtgcaaccgaccgtcgggcctggagccgcagccgggcgtcttcgactgcctgcgcgac
gccatggtgcgcgactacgtgcgccagacctggaagctggagggcgaggccctggagcag
gccatcatcagccaggcaccgcaggtggagaaacttattgctacgacggcccacgagcgg
atgccctggtaccacagcagcctgacgcgtgaggaggccgagcgcaaactttactctggg
acccagaccgacggcaagttcctgctgaggccgcggaaggagcagggcacgtatgccctg
tccctcatctatgggaagacggtgtaccactacctcatcagccaagacaaggcgggcaag
tactgcattcccgagggcaccaagtttgacacgctctggcagctggtggagtatctgaag
ctgaaggcggatgggctcatctactgcctgaaggaggcctgtcccaacagcagcgccagc
agtgcctcaggggctgctgctcccacgctcccagcccacccatccacgttcactcaccct
cagagacggatcgacaccctcaactcagatggatacacccctgagccagcgcgcgtaacg
tccccagagaaaccgcggccgatgcccatggacaccagcgtgtatgagagcccctacagc
gacccagaggagctcaaggacaagaagctcttcctgaagcgcgataacctcctcatagcc
gacattgaacttggctgcggcaactttggctcagtgcgccagggcgtgtaccgcatgcgc
aagaagcagattgacgtggccatcaaggtgctgaagcagggcacggagaaggcggacacg
gaggagatgatgcgggaggcacagatcatgcaccagctggacaacccctacatcgtgcgg
ctcattggcgtctgccaggctgaggccctcatgctcgtcatggagatggctggcagcggg
ccgctgcacaagttcctggccggcaagaaggaggagatccccgtgagcaatgtggccgag
ctgctgcaccaggtgtccatggggatgaagtacctggaggagaagaacttcgtgcaccgt
gacctggcggcccgcaacgtgctgctggttaaccggcactacgccaagatcagcgatttc
ggcctctccaaagcactgggcgccgatgacagttattacactgcccgctcagcagggaag
tggccgctcaagtggtacgcacccgagtgcatcaacttccgcaagttctccagccgcagc
gatgtctggagctacggggtcaccatgtgggaggccttgtcctacggccagaagccctac
aagaagatgaaagggccggaggtcatggccttcatcgagcagggcaagcggatggagtgc
ccatcagagtgtccgcctgaactgtacgaactcatgagcgactgctggatctacaagtgg
gaggatcgccccgacttcctgaccgtggagcagcgcatgcgggcctgttactacagcctg
gccagcaaagcggagggctccccgggctgcgcgcagaaggccgaggctgcctgtgcctga

DBGET integrated database retrieval system