KEGG   Macaca mulatta (rhesus monkey): 707637
Entry
707637            CDS       T01028                                 

Gene name
CDC42
Definition
(RefSeq) cell division control protein 42 homolog
  KO
K04393  cell division control protein 42
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04010  MAPK signaling pathway
mcc04014  Ras signaling pathway
mcc04015  Rap1 signaling pathway
mcc04062  Chemokine signaling pathway
mcc04144  Endocytosis
mcc04360  Axon guidance
mcc04370  VEGF signaling pathway
mcc04510  Focal adhesion
mcc04520  Adherens junction
mcc04530  Tight junction
mcc04660  T cell receptor signaling pathway
mcc04666  Fc gamma R-mediated phagocytosis
mcc04670  Leukocyte transendothelial migration
mcc04722  Neurotrophin signaling pathway
mcc04810  Regulation of actin cytoskeleton
mcc04912  GnRH signaling pathway
mcc04932  Non-alcoholic fatty liver disease
mcc04933  AGE-RAGE signaling pathway in diabetic complications
mcc05100  Bacterial invasion of epithelial cells
mcc05132  Salmonella infection
mcc05135  Yersinia infection
mcc05165  Human papillomavirus infection
mcc05200  Pathways in cancer
mcc05203  Viral carcinogenesis
mcc05205  Proteoglycans in cancer
mcc05211  Renal cell carcinoma
mcc05212  Pancreatic cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    707637 (CDC42)
   04014 Ras signaling pathway
    707637 (CDC42)
   04015 Rap1 signaling pathway
    707637 (CDC42)
   04370 VEGF signaling pathway
    707637 (CDC42)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    707637 (CDC42)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    707637 (CDC42)
   04520 Adherens junction
    707637 (CDC42)
   04530 Tight junction
    707637 (CDC42)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    707637 (CDC42)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    707637 (CDC42)
   04666 Fc gamma R-mediated phagocytosis
    707637 (CDC42)
   04670 Leukocyte transendothelial migration
    707637 (CDC42)
   04062 Chemokine signaling pathway
    707637 (CDC42)
  09152 Endocrine system
   04912 GnRH signaling pathway
    707637 (CDC42)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    707637 (CDC42)
  09158 Development and regeneration
   04360 Axon guidance
    707637 (CDC42)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    707637 (CDC42)
   05205 Proteoglycans in cancer
    707637 (CDC42)
   05203 Viral carcinogenesis
    707637 (CDC42)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    707637 (CDC42)
   05211 Renal cell carcinoma
    707637 (CDC42)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    707637 (CDC42)
   04933 AGE-RAGE signaling pathway in diabetic complications
    707637 (CDC42)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    707637 (CDC42)
   05135 Yersinia infection
    707637 (CDC42)
   05100 Bacterial invasion of epithelial cells
    707637 (CDC42)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    707637 (CDC42)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mcc04131]
    707637 (CDC42)
   03036 Chromosome and associated proteins [BR:mcc03036]
    707637 (CDC42)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcc04147]
    707637 (CDC42)
   04031 GTP-binding proteins [BR:mcc04031]
    707637 (CDC42)
Membrane trafficking [BR:mcc04131]
 Exocytosis
  Small GTPases and associated proteins
   Rho GTPases
    707637 (CDC42)
 Endocytosis
  Lipid raft mediated endocytosis
   GRAF1-dependent endocytosis
    707637 (CDC42)
  Macropinocytosis
   Ras GTPases
    707637 (CDC42)
Chromosome and associated proteins [BR:mcc03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    707637 (CDC42)
Exosome [BR:mcc04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   707637 (CDC42)
  Exosomal proteins of breast milk
   707637 (CDC42)
GTP-binding proteins [BR:mcc04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    707637 (CDC42)
SSDB
Motif
Pfam: Ras Roc Arf PET117 GTP_EFTU
Other DBs
NCBI-GeneID: 707637
NCBI-ProteinID: NP_001244809
Ensembl: ENSMMUG00000022009
UniProt: F7FVX9
LinkDB
Position
1
AA seq 191 aa
MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAG
QEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLR
DDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPP
EPKKSRRCVLL
NT seq 576 nt   +upstreamnt  +downstreamnt
atgcagacaattaagtgtgttgttgtgggcgatggtgctgttggtaaaacatgtctcctg
atatcctacacaacaaacaaatttccatcggaatatgtaccaactgtttttgacaactat
gcagtcacagttatgattggtggagaaccatatactcttggactttttgatactgcaggg
caagaggattatgacagattacgaccgctgagttatccacagacagatgtatttctagtc
tgtttttcagtggtctctccatcttcatttgaaaatgtgaaagaaaagtgggtgcctgag
ataactcaccactgtccaaagactcctttcttgcttgttgggactcaaattgatctcaga
gatgacccctccactattgagaaacttgccaagaacaaacagaagcctatcactccagag
actgctgaaaagctggcccgtgacctgaaggctgtcaagtatgtggagtgttctgcactt
acacagaaaggcctaaagaatgtatttgacgaagcaatattggctgccctggagcctcca
gaaccgaagaagagccgcaggtgtgtgctgctatga

DBGET integrated database retrieval system