KEGG   Macaca mulatta (rhesus monkey): 708013
Entry
708013            CDS       T01028                                 

Gene name
RIPK1
Definition
(RefSeq) receptor-interacting serine/threonine-protein kinase 1 isoform X2
  KO
K02861  receptor-interacting serine/threonine-protein kinase 1 [EC:2.7.11.1]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04064  NF-kappa B signaling pathway
mcc04210  Apoptosis
mcc04217  Necroptosis
mcc04620  Toll-like receptor signaling pathway
mcc04621  NOD-like receptor signaling pathway
mcc04622  RIG-I-like receptor signaling pathway
mcc04623  Cytosolic DNA-sensing pathway
mcc04668  TNF signaling pathway
mcc05132  Salmonella infection
mcc05160  Hepatitis C
mcc05163  Human cytomegalovirus infection
mcc05169  Epstein-Barr virus infection
mcc05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    708013 (RIPK1)
   04668 TNF signaling pathway
    708013 (RIPK1)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    708013 (RIPK1)
   04217 Necroptosis
    708013 (RIPK1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    708013 (RIPK1)
   04621 NOD-like receptor signaling pathway
    708013 (RIPK1)
   04622 RIG-I-like receptor signaling pathway
    708013 (RIPK1)
   04623 Cytosolic DNA-sensing pathway
    708013 (RIPK1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    708013 (RIPK1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    708013 (RIPK1)
   05160 Hepatitis C
    708013 (RIPK1)
   05163 Human cytomegalovirus infection
    708013 (RIPK1)
   05169 Epstein-Barr virus infection
    708013 (RIPK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcc01001]
    708013 (RIPK1)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     708013 (RIPK1)
Protein kinases [BR:mcc01001]
 Serine/threonine kinases: TKL group
  RIPK family [OT]
   708013 (RIPK1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Death RHIM RIO1 Pkinase_fungal Kdo Kinase-like
Other DBs
NCBI-GeneID: 708013
NCBI-ProteinID: XP_001091986
Ensembl: ENSMMUG00000008485
LinkDB
Position
4
AA seq 671 aa
MQPDMSLNVIKMKSSDFLERAELDSGGFGKVSLCFHRTQGFVIMKTVYRGPNCSEHNEAL
LEEAKMMNRLRHSRVVKLLGVIIEEGNYSLVMEYMEKGNLMHVLKAEMSTPLSVKGRIIV
EIIEGMCYLHGKGVIHKDLKPENILVDDDFHIKIADLGLASFKMWSKLSKEEHNELKEVD
GTSKKNGGTLYYMAPEHLNDVNAKPTEKSDVYSFAVVLWAIFANKEPYENAICEQQLIMC
IKSGNRPDVDDIIEYCPREIISLMKLCWEANPEARPTFPGIEEKFRPFYLSQLEESVEED
VKSLKKEYSNQNAVVKRMQSLQLDCVPVPPSRSNSATEQPGSLHSSQGLGMGPVEESWFA
PSLEHQQEENEPSLQSKLQEEANYHLYGSRMDRQMKQQPRQNVAYNREEERRRRVSHDPF
AQQRPYENFQNTEVKGTAYSSAASHGNAVPQPSGLSSQPQVPYRNNVLYSSHGFGTRPLD
PGTAGPRVWYGPIPSPMSSLYKIPVPETNYLGNTPTMPFTSLPLTDESIKYAIYNSTGIQ
IGAYNYMEVGGTSSSLLDNTNTNFKEEPASKYQAIFDNTTSLTDKHLDPIRENLGKHWKN
CARKLGFTQSQIDEIDHDYERDGLKEKVYQMLQKWVMREGIKGATVGKLAQVLHQCARID
LLNHLIYVSQN
NT seq 2016 nt   +upstreamnt  +downstreamnt
atgcaaccagacatgtccttgaatgtcattaagatgaaatccagtgacttcctggagagg
gcagaactggacagcggaggcttcgggaaggtgtctctgtgtttccacagaacccagggc
ttcgtgatcatgaaaacagtgtacagggggcccaactgcagcgagcacaacgaggccctc
ctggaggaggcgaagatgatgaacagactgaggcacagccgagtggtaaagctcctgggc
gtcatcatagaggaagggaactactccctggtgatggagtacatggagaagggcaacctg
atgcacgtgctaaaagccgagatgagtactccgctttctgtaaaaggaaggataattgtg
gaaatcattgaagggatgtgctacttacatggaaaaggcgtgatacacaaggacctgaag
cctgaaaatatccttgttgatgatgacttccacattaagatcgcagacctcggccttgct
tcctttaagatgtggagcaaactgagtaaagaagagcacaatgagctgaaggaagtggac
ggcacctctaagaagaacggcggcaccctctactacatggcgcctgagcacctgaacgac
gtcaacgcaaagcccacggagaagtcagatgtgtacagctttgccgtcgtactttgggcg
atatttgcaaataaggagccatatgaaaatgctatctgtgagcagcagctgataatgtgc
ataaaatcggggaacaggccagatgtggacgacatcattgagtactgcccaagagaaatt
atcagcctcatgaagctgtgctgggaagcgaatccagaagctcggccgacatttcctggc
attgaagaaaaatttaggcctttttatttaagtcaattagaagaaagtgtagaagaggat
gtgaagagtttaaagaaagagtattcaaaccaaaatgcagttgtgaagagaatgcagtct
ctccaacttgattgtgtgccagtgcctccgagcaggtcaaattcagccacagaacagcct
ggttcactgcacagttcccagggacttgggatgggtcctgtggaggagtcctggtttgcc
ccctccctggagcaccagcaagaagagaatgagcccagtctgcagagtaaactccaagag
gaagcaaactaccatctctatggcagccgcatggacaggcagatgaaacagcagcccaga
cagaatgtggcttacaacagagaggaggaaaggagacgaagggtctcccatgaccctttt
gcacagcaaagaccttatgagaattttcagaatacagaggtaaaaggcaccgcttattct
agtgcagccagtcatggtaatgcagtgccccagccctcagggcttagcagccaacctcaa
gtgccatatcggaacaatgttttatatagctcacatggctttggaacaagaccgctggat
ccaggaacagcaggtcccagagtttggtatgggccaattccaagtcctatgtctagtctg
tataaaatcccggtgcctgagaccaactatttaggaaacacacccacgatgccattcacc
tccttgccactaacagatgaatctataaaatatgctatatacaatagtactggcattcag
attggagcctacaattatatggaggttggtgggacgagttcatcactactagacaacaca
aatacgaactttaaagaagagccagcttccaagtaccaagctatctttgataataccact
agtctgaccgataaacacctggacccaatcagggaaaatctgggaaagcactggaaaaac
tgtgcccggaaactgggcttcacacagtctcagattgatgaaattgaccatgactatgag
cgagatggactaaaagaaaaggtttaccagatgctccaaaagtgggtgatgagggaaggc
attaagggagccacagtggggaagctggcccaggtgctccaccagtgtgccaggatcgac
cttctgaaccacttgatttacgtcagccagaactaa

DBGET integrated database retrieval system