KEGG   Macaca mulatta (rhesus monkey): 708017
Entry
708017            CDS       T01028                                 

Gene name
IL2
Definition
(RefSeq) interleukin-2 precursor
  KO
K05429  interleukin 2
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04060  Cytokine-cytokine receptor interaction
mcc04061  Viral protein interaction with cytokine and cytokine receptor
mcc04151  PI3K-Akt signaling pathway
mcc04625  C-type lectin receptor signaling pathway
mcc04630  JAK-STAT signaling pathway
mcc04658  Th1 and Th2 cell differentiation
mcc04659  Th17 cell differentiation
mcc04660  T cell receptor signaling pathway
mcc04672  Intestinal immune network for IgA production
mcc04940  Type I diabetes mellitus
mcc05135  Yersinia infection
mcc05142  Chagas disease
mcc05162  Measles
mcc05166  Human T-cell leukemia virus 1 infection
mcc05200  Pathways in cancer
mcc05320  Autoimmune thyroid disease
mcc05321  Inflammatory bowel disease
mcc05330  Allograft rejection
mcc05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    708017 (IL2)
   04151 PI3K-Akt signaling pathway
    708017 (IL2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    708017 (IL2)
   04061 Viral protein interaction with cytokine and cytokine receptor
    708017 (IL2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    708017 (IL2)
   04660 T cell receptor signaling pathway
    708017 (IL2)
   04658 Th1 and Th2 cell differentiation
    708017 (IL2)
   04659 Th17 cell differentiation
    708017 (IL2)
   04672 Intestinal immune network for IgA production
    708017 (IL2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    708017 (IL2)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    708017 (IL2)
   05321 Inflammatory bowel disease
    708017 (IL2)
   05330 Allograft rejection
    708017 (IL2)
   05332 Graft-versus-host disease
    708017 (IL2)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    708017 (IL2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    708017 (IL2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    708017 (IL2)
   05162 Measles
    708017 (IL2)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    708017 (IL2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcc04052]
    708017 (IL2)
   00536 Glycosaminoglycan binding proteins [BR:mcc00536]
    708017 (IL2)
Cytokines and growth factors [BR:mcc04052]
 Cytokines
  Interleukins
   708017 (IL2)
Glycosaminoglycan binding proteins [BR:mcc00536]
 Heparan sulfate / Haparin
  Cytokines
   708017 (IL2)
SSDB
Motif
Pfam: IL2 Plasmid_RAQPRD
Other DBs
NCBI-GeneID: 708017
NCBI-ProteinID: NP_001040595
Ensembl: ENSMMUG00000021093
UniProt: P68291
LinkDB
Position
5
AA seq 154 aa
MYRMQLLSCIALSLALVTNSAPTSSSTKKTQLQLEHLLLDLQMILNGINNYKNPKLTRML
TFKFYMPKKATELKHLQCLEEELKPLEEVLNLAQSKNFHLRDTKDLISNINVIVLELKGS
ETTLMCEYADETATIVEFLNRWITFCQSIISTLT
NT seq 465 nt   +upstreamnt  +downstreamnt
atgtacaggatgcaactcctgtcttgcattgcactaagtcttgcacttgtcacaaacagt
gcacctacttcaagttctacaaagaaaacacagctacaactggagcatttactgctggat
ttacagatgattttgaatggaattaataattacaagaatcccaaactcaccaggatgctc
acatttaagttttacatgcccaagaaggccacagaattgaaacatcttcagtgtctagaa
gaagaactcaaacctctggaggaagtgctaaatttagctcaaagcaaaaactttcactta
agagataccaaggacttaatcagcaatatcaacgtaatagttctggaactaaagggatct
gaaacaacactgatgtgtgaatatgctgatgagacagcaaccattgtagaatttctgaac
agatggattaccttttgtcaaagcatcatctcaacactgacctga

DBGET integrated database retrieval system