KEGG   Macaca mulatta (rhesus monkey): 708018Help
Entry
708018            CDS       T01028                                 

Gene name
SDHA
Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc00020  Citrate cycle (TCA cycle)
mcc00190  Oxidative phosphorylation
mcc01100  Metabolic pathways
mcc01200  Carbon metabolism
mcc04714  Thermogenesis
mcc04932  Non-alcoholic fatty liver disease (NAFLD)
mcc05010  Alzheimer disease
mcc05012  Parkinson disease
mcc05016  Huntington disease
Module
mcc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mcc_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
mcc_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    708018 (SDHA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    708018 (SDHA)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    708018 (SDHA)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    708018 (SDHA)
   05012 Parkinson disease
    708018 (SDHA)
   05016 Huntington disease
    708018 (SDHA)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    708018 (SDHA)
Enzymes [BR:mcc01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     708018 (SDHA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA FAD_binding_3 DAO HI0933_like
Motif
Other DBs
NCBI-GeneID: 708018
NCBI-ProteinID: XP_028705134
Ensembl: ENSMMUG00000014452
LinkDB All DBs
Position
6
AA seq 664 aa AA seqDB search
MSGVRRLSRLLSTRRLALAKAWPAVLQTGTRGFHFTVDGNKRASAKVSDSISAQYPVVDH
EFDAVVVGAGGAGLRAAFGLSEAGFNTACVTKLFPTRSHTVAAQGGINAALGNMEEDNWR
WHFYDTVKGSDWLGDQDAIHYMTEQAPAAVVELENYGMPFSRTEDGKIYQRAFGGQSLKF
GKGGQAHRCCCVADRTGHSLLHTLYGRSLRYDTSYFVEYFALDLLMEDGECRGVIALCIE
DGSIHRIRAKNTVVATGGYGRTYFSCTSAHTSTGDGTAMITRAGLPCQDLEFVQFHPTGI
YGAGCLITEGCRGEGGILINSQGERFMERYAPVAKDLASRDVVSRSMTLEIREGRGCGPE
KDHVYLQLHHLPPEQLATRLPGISETAMIFAGVDVTKEPIPVLPTVHYNMGGIPTNYKGQ
VLRHVNGQDQIVPGLYACGEAACASVHGANRLGANSLLDLVVFGRACALSIEESCRPGDK
VPPIKPNAGEESVMNLDKLRFADGSIRTSELRLSMQKSMQNHAAVFRVGSVLQEGCGKIS
KLYGDLKHLKTFDRGMVWNTDLVETLELQNLMLCALQTIYGAEARKESRGAHAREDYKVR
IDEYDYSKPIQGQQKKPFEEHWRKHTLSYVDVSTGKVTLEYRPVIDKTLNEADCATVPPA
IRSY
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggggtccggagactgtcgcggctgctgagcactcggcgcctggcgctggccaag
gcgtggccagcagtgttgcaaacaggaacccgaggttttcacttcactgttgatgggaac
aagagggcatctgctaaagtttcagattccatttctgctcagtatccagtagtggatcat
gaatttgatgcggtggtggtaggcgctggaggggcaggcttgcgagctgcatttggcctt
tctgaggcagggtttaatacagcatgtgttacaaagctgtttcctaccaggtcacacact
gttgcggcacagggaggaatcaatgctgctctggggaacatggaggaggacaactggagg
tggcatttctacgacaccgtgaagggctccgactggctgggggaccaggatgccatccac
tacatgacagagcaggctcccgccgccgtggtcgagctggaaaattacggcatgccgttt
agcagaactgaagatgggaagatttatcagcgtgcatttggtggacagagcctcaagttt
ggaaagggcgggcaggcccatcggtgctgctgtgtggctgatcggaccggccactcacta
ttgcacaccttatatggaaggtctctgcgatacgataccagctattttgtggagtatttt
gccttggatctcctgatggaggacggggagtgccgtggtgtcatcgcactgtgcatagag
gacgggtccatccatcgcatacgagcaaagaacactgttgttgccacaggaggctacggg
cgcacctacttcagctgcacgtctgcccacaccagcaccggcgacggcacggccatgatc
accagggcaggccttccttgccaggacctagagttcgttcagttccaccccacaggcata
tatggtgccggttgtctcattacggaaggatgtcgtggagagggaggcattctcattaac
agtcaaggcgaaaggtttatggagcgatacgccccggtggcgaaggacctggcgtctaga
gatgtggtgtctcggtcgatgactctggagatccgcgaaggaagaggctgtggccctgag
aaagatcacgtctacctgcagctgcaccacctgcctccggagcagctggccacgcgcctg
cccggcatttcagagacagccatgatcttcgctggtgtggacgtcacgaaggagccgatc
cctgtcctccccaccgtgcattataacatgggcggcattcccaccaactacaaggggcag
gtcctgaggcacgtgaatggccaggatcagattgtgcccgggctgtacgcctgtggggag
gccgcctgtgcctcggtacatggtgccaaccggctcggggcaaactccctcttggacctg
gtcgtctttggtcgggcatgtgccctgagcatcgaagagtcgtgcaggcctggagataaa
gtccctccaattaaaccaaatgctggagaagaatctgtcatgaatcttgacaaattgaga
tttgctgacggaagcataagaacgtcagaacttcgactcagcatgcagaagtcaatgcaa
aatcatgctgccgtgttccgtgtgggaagcgtgttgcaagaaggttgtgggaaaatcagc
aagctctacggagacctgaagcacctgaagacatttgaccggggaatggtctggaacacg
gacctggtggagaccctggagctgcagaacctgatgctgtgtgcgctgcagaccatctac
ggagcagaggcgcggaaggagtcacggggcgcacacgccagggaagactacaaggtgcgg
attgatgagtacgattactccaagcccatccaggggcaacagaagaagccttttgaggag
cactggaggaagcacaccctgtcctatgtggacgtcagcactgggaaggtcactctggaa
tatagacccgtaatcgacaaaactttgaacgaggctgactgtgccaccgtccccccagcc
attcgctcctactga

DBGET integrated database retrieval system