KEGG   Macaca mulatta (rhesus monkey): 708084
Entry
708084            CDS       T01028                                 

Gene name
MMP9
Definition
(RefSeq) matrix metalloproteinase-9 precursor
  KO
K01403  matrix metalloproteinase-9 (gelatinase B) [EC:3.4.24.35]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc01522  Endocrine resistance
mcc04657  IL-17 signaling pathway
mcc04668  TNF signaling pathway
mcc04670  Leukocyte transendothelial migration
mcc04915  Estrogen signaling pathway
mcc04926  Relaxin signaling pathway
mcc05161  Hepatitis B
mcc05200  Pathways in cancer
mcc05202  Transcriptional misregulation in cancer
mcc05205  Proteoglycans in cancer
mcc05206  MicroRNAs in cancer
mcc05215  Prostate cancer
mcc05219  Bladder cancer
mcc05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    708084 (MMP9)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    708084 (MMP9)
   04670 Leukocyte transendothelial migration
    708084 (MMP9)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    708084 (MMP9)
   04926 Relaxin signaling pathway
    708084 (MMP9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    708084 (MMP9)
   05202 Transcriptional misregulation in cancer
    708084 (MMP9)
   05206 MicroRNAs in cancer
    708084 (MMP9)
   05205 Proteoglycans in cancer
    708084 (MMP9)
  09162 Cancer: specific types
   05219 Bladder cancer
    708084 (MMP9)
   05215 Prostate cancer
    708084 (MMP9)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    708084 (MMP9)
  09172 Infectious disease: viral
   05161 Hepatitis B
    708084 (MMP9)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    708084 (MMP9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mcc01002]
    708084 (MMP9)
Enzymes [BR:mcc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.35  gelatinase B
     708084 (MMP9)
Peptidases and inhibitors [BR:mcc01002]
 Metallo peptidases
  Family M10
   708084 (MMP9)
SSDB
Motif
Pfam: Peptidase_M10 fn2 Hemopexin PG_binding_1 PT Reprolysin_5 Reprolysin_3 Reprolysin_4 DUF4953
Other DBs
NCBI-GeneID: 708084
NCBI-ProteinID: NP_001253834
Ensembl: ENSMMUG00000016549
UniProt: H9Z944 G7N4M8
LinkDB
Position
10
AA seq 707 aa
MSLWQPLVLALLVLGCCCAAPRQRQSTLVLFPGDLKTNLTDRQLAEDYLYRYGYTRVAEM
HGDSKSLGPALLLLQKQLSLPQTGELDSATLKAMRTPRCGVPDLGRFQTFEGDLKWHHHN
ITYWIQNYSEDLPRAVIEDAFARAFALWSAVTPLTFTRVYSRDADIVIQFGVAEHGDGYP
FDGKDGLLAHAFPPGPGIQGDAHFDDDELWSLGKGVVVPTKFGNADGAACHFPFTFEGRS
YSACTTDGRSDGVPWCSTTANYDTDRRFGFCPSERLYTQDGNADGKPCQFPFIFQGQSYS
ACTTDGRSDGYRWCATTANYDQDKLYGFCPTRADSTVIGGNSAGELCVFPFTFLGKEYST
CTSEGRGDGRLWCATTSNFDRDKKWGFCPDQGYSLFLVAAHEFGHALGLDHTSVPEALMY
PMYRFTEEPPLHKDDVNGIQYLYGSRPEPEPRPPTTTTPQPTAPPTVCPTGPPTVRPSDR
PTAGPTGPPSAGPTGPPTAGPSTTTTVPLNPVDDACNVNIFDAITEIGNQLYLFKDGRYW
RFSERRGSRLQGPFLIADTWPALPRKLDSAFEEPLSKKLFFFSGRQVWVYTGASVLGPRR
LDKLGLGADVAQVTGALRRGAGKMLLFSGRRFWRFDVKAQMVDPRSASEVDRMFPGVPLD
THDVFQYQEKAYFCQDRFYWRVSFQSGVNQVDQVGYVTYDILQCPED
NT seq 2124 nt   +upstreamnt  +downstreamnt
atgagcctctggcagcccctggtcctggcgctcctggtgctgggctgctgctgtgctgcc
cccagacagcgccagtccacccttgtgctcttccctggagacctgaaaaccaatctcact
gacaggcagctggcagaggactacctgtaccgctatggttacactcgggtggcagagatg
catggagactcgaaatctctggggcctgcgctgctgcttctccagaagcaactgtccctg
ccccagaccggtgagctggacagcgccacgctgaaggccatgcgaaccccacggtgcggg
gtcccagacctgggcagattccaaacctttgagggcgacctcaagtggcaccaccacaac
atcacctattggatccaaaactactcggaagacttgccgcgggcggtgattgaagacgcc
tttgcccgcgccttcgcgctgtggagcgcggtgacgccgctcaccttcactcgcgtgtac
agccgggacgcagacattgtcatccagtttggtgtcgcggagcacggagacgggtatccc
ttcgacgggaaggacgggctcctggcacacgcctttcctcctgggcccggcattcaggga
gacgcccatttcgacgatgacgagttgtggtcgctgggcaagggcgtcgtggttccaact
aagtttggaaacgcagatggcgcggcctgccacttccccttcaccttcgagggccgctcc
tactctgcctgcaccacagacggtcgctccgacggcgtgccctggtgcagtaccacagcc
aactacgacactgaccgccggtttggcttctgtcccagcgagagactctacacccaggac
ggcaatgctgacgggaaaccctgccagtttccattcatcttccaaggccaatcctactcc
gcctgcaccacggacggtcgctccgacggctaccgctggtgcgccaccaccgccaactac
gaccaggacaagctctacggcttctgcccgacccgagccgactcgaccgtgatcgggggc
aactcggcgggggagctgtgcgttttccccttcaccttcctgggtaaggagtactcgacc
tgtaccagcgagggccgcggagatgggcgcctctggtgcgctaccacctcgaactttgac
agagacaagaagtggggcttctgcccggaccaaggatacagtctgttcctcgtggcagct
cacgaattcggccacgcgctgggcttagatcatacctcagtgccggaggcgctcatgtac
cctatgtaccgattcactgaggagccccccttgcataaggacgacgtgaatggcatccag
tatctctatggttctcgccctgaacctgagccacggcctccaaccaccaccacaccgcag
cccacggctcccccgacggtctgccccactggaccccccactgtccgcccctcagaccgc
cccacagccggccccacaggtcccccctcagctggccccacaggtccccccactgctggc
ccttctacgaccactactgtgcctttgaatccggtggacgatgcctgcaacgtgaacatc
ttcgacgccatcacggagatcgggaaccagctgtatctgttcaaggatgggaggtactgg
cgattctccgagcgcagggggagccggctgcagggccccttccttatcgccgacacgtgg
cccgcgttgccccgcaagctggactcggcctttgaggagccgctctccaagaagcttttc
ttcttctctgggcgccaggtgtgggtgtacacaggcgcgtcggtgctgggcccgaggcgt
ctagacaagctgggcctgggcgccgacgtggcccaggtgaccggggccctccggcgtggc
gcggggaagatgctgctattcagcgggcggcgcttctggaggttcgacgtgaaggcgcag
atggtggatccccggagcgccagcgaggtagaccggatgttccccggggtgcctttggac
acgcacgacgtcttccagtaccaagagaaagcctatttctgccaggaccgcttctactgg
cgcgtgagtttccagagtggggtgaaccaggtggaccaagtgggctacgtgacctatgac
atcctgcagtgccctgaggactag

DBGET integrated database retrieval system