KEGG   Macaca mulatta (rhesus monkey): 708170
Entry
708170            CDS       T01028                                 

Gene name
ARF6
Definition
(RefSeq) ADP-ribosylation factor 6
  KO
K07941  ADP-ribosylation factor 6
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04014  Ras signaling pathway
mcc04072  Phospholipase D signaling pathway
mcc04144  Endocytosis
mcc04666  Fc gamma R-mediated phagocytosis
mcc05132  Salmonella infection
mcc05135  Yersinia infection
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    708170 (ARF6)
   04072 Phospholipase D signaling pathway
    708170 (ARF6)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    708170 (ARF6)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    708170 (ARF6)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    708170 (ARF6)
   05135 Yersinia infection
    708170 (ARF6)
Membrane trafficking [BR:mcc04131]
 Endocytosis
  Lipid raft mediated endocytosis
   Arf6-dependent endocytosis
    708170 (ARF6)
  Arf GTPases and associated proteins
   Arf GTPases
    708170 (ARF6)
Exosome [BR:mcc04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   708170 (ARF6)
  Exosomal proteins of colorectal cancer cells
   708170 (ARF6)
GTP-binding proteins [BR:mcc04031]
 Small (monomeric) G-proteins
  Arf/Sar Family
   Arf [OT]
    708170 (ARF6)
SSDB
Motif
Pfam: Arf Roc Ras SRPRB G-alpha Gtr1_RagA MMR_HSR1 6PF2K SpoOE-like
Other DBs
NCBI-GeneID: 708170
NCBI-ProteinID: NP_001180987
Ensembl: ENSMMUG00000041889
UniProt: F6RLV0 G7MXQ3
LinkDB
Position
7
AA seq 175 aa
MGKVLSKIFGNKEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFN
VWDVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIF
ANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTSNYKS
NT seq 528 nt   +upstreamnt  +downstreamnt
atggggaaggtgctatccaaaatcttcgggaacaaggaaatgcggatcctcatgttgggc
ctggacgcggccggcaagacaacaatcctgtacaagttgaagctgggccagtcggtgacc
accattcccactgtgggtttcaacgtggagacggtgacttacaaaaatgtcaagttcaac
gtatgggatgtgggcggccaggacaagatccggccgctctggcggcattactacactggg
acccaaggtctgatcttcgtagtggactgcgccgaccgcgaccgcatcgatgaggctcgc
caggagctgcaccgcattatcaatgaccgggagatgagggacgccataatcctcatcttc
gccaacaagcaggacctgcctgatgccatgaaaccccacgagatccaggagaaactgggc
ctgacccggattcgggacaggaactggtatgtgcagccctcctgtgccacctcaggggac
ggactctatgaggggctcacatggttaacctctaactacaaatcttaa

DBGET integrated database retrieval system