KEGG   Macaca mulatta (rhesus monkey): 708227
Entry
708227            CDS       T01028                                 

Gene name
IGF1R
Definition
(RefSeq) insulin-like growth factor 1 receptor precursor
  KO
K05087  insulin-like growth factor 1 receptor [EC:2.7.10.1]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc01521  EGFR tyrosine kinase inhibitor resistance
mcc01522  Endocrine resistance
mcc04010  MAPK signaling pathway
mcc04014  Ras signaling pathway
mcc04015  Rap1 signaling pathway
mcc04066  HIF-1 signaling pathway
mcc04068  FoxO signaling pathway
mcc04114  Oocyte meiosis
mcc04140  Autophagy - animal
mcc04144  Endocytosis
mcc04150  mTOR signaling pathway
mcc04151  PI3K-Akt signaling pathway
mcc04152  AMPK signaling pathway
mcc04211  Longevity regulating pathway
mcc04213  Longevity regulating pathway - multiple species
mcc04510  Focal adhesion
mcc04520  Adherens junction
mcc04550  Signaling pathways regulating pluripotency of stem cells
mcc04730  Long-term depression
mcc04913  Ovarian steroidogenesis
mcc04914  Progesterone-mediated oocyte maturation
mcc05200  Pathways in cancer
mcc05202  Transcriptional misregulation in cancer
mcc05205  Proteoglycans in cancer
mcc05214  Glioma
mcc05215  Prostate cancer
mcc05218  Melanoma
mcc05224  Breast cancer
mcc05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    708227 (IGF1R)
   04014 Ras signaling pathway
    708227 (IGF1R)
   04015 Rap1 signaling pathway
    708227 (IGF1R)
   04066 HIF-1 signaling pathway
    708227 (IGF1R)
   04068 FoxO signaling pathway
    708227 (IGF1R)
   04151 PI3K-Akt signaling pathway
    708227 (IGF1R)
   04152 AMPK signaling pathway
    708227 (IGF1R)
   04150 mTOR signaling pathway
    708227 (IGF1R)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    708227 (IGF1R)
   04140 Autophagy - animal
    708227 (IGF1R)
  09143 Cell growth and death
   04114 Oocyte meiosis
    708227 (IGF1R)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    708227 (IGF1R)
   04520 Adherens junction
    708227 (IGF1R)
   04550 Signaling pathways regulating pluripotency of stem cells
    708227 (IGF1R)
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    708227 (IGF1R)
   04914 Progesterone-mediated oocyte maturation
    708227 (IGF1R)
  09156 Nervous system
   04730 Long-term depression
    708227 (IGF1R)
  09149 Aging
   04211 Longevity regulating pathway
    708227 (IGF1R)
   04213 Longevity regulating pathway - multiple species
    708227 (IGF1R)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    708227 (IGF1R)
   05202 Transcriptional misregulation in cancer
    708227 (IGF1R)
   05205 Proteoglycans in cancer
    708227 (IGF1R)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    708227 (IGF1R)
   05214 Glioma
    708227 (IGF1R)
   05218 Melanoma
    708227 (IGF1R)
   05215 Prostate cancer
    708227 (IGF1R)
   05224 Breast cancer
    708227 (IGF1R)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    708227 (IGF1R)
   01522 Endocrine resistance
    708227 (IGF1R)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcc01001]
    708227 (IGF1R)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mcc04090]
    708227 (IGF1R)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     708227 (IGF1R)
Protein kinases [BR:mcc01001]
 Receptor tyrosine kinases (RTK)
  INSR family [OT]
   708227 (IGF1R)
CD molecules [BR:mcc04090]
 Proteins
  708227 (IGF1R)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain Pkinase Furin-like fn3 Kinase-like Insulin_TMD DUF4476
Other DBs
NCBI-GeneID: 708227
NCBI-ProteinID: NP_001248281
Ensembl: ENSMMUG00000012305
UniProt: I2CWY3 G7MWA6
LinkDB
Position
7
AA seq 1367 aa
MKSGSGEGSPTSLWGLLFLSAALSLWPTSGEICGPGIDIRNDYQQLKRLENCTVIEGYLH
ILLISKAEDYRSYRFPKLTVITEYLLLFRVAGLESLGDLFPNLTVIRGWKLFYNYALVIF
EMTNLKDIGLYNLRNITRGAIRIEKNADLCYLSTVDWSLILDAVSNNYIVGNKPPKECGD
LCPGTMEEKPMCEKTTINNEYNYRCWTTNRCQKMCPSACGKRACTENNECCHPECLGSCS
APDNDTACVACRHYYYAGVCVPACPPNTYRFEGWRCVDRDFCANILSAESSDSEGFVIHD
GECMQECPSGFIRNGSQSMYCIPCEGPCPKVCEEEKKTKTIDSVTSAQMLQGCTIFKGNL
LINIRRGNNIASELENFMGLIEVVTGYVKIRHSHALVSLSFLKNLRLILGEEQLEGNYSF
YVLDNQNLQQLWDWDHRNLTIKAGKMYFAFNPKLCVSEIYRMEEVTGTKGRQSKGDINTR
NNGERASCESDVLHFTSTTTWKNRIIITWHRYRPPDYRDLISFTVYYKEAPFKNVTEYDG
QDACGSNSWNMVDVDLPPNKDVEPGILLHGLKPWTQYAVYVKAVTLTMVENDHIRGAKSE
ILYIRTNASVPSIPLDVLSASNSSSQLIVKWNPPSLPNGNLSYYIVRWQRQPQDGYLYRH
NYCSKDKIPIRKYADGTIDIEEVTENPKTEVCGGEKGPCCACPKTEAEKQAEKEEAEYRK
VFENFLHNSIFVPRPERKRRDVMQVANTTMSSRSRNTTVADTYNITDLEELETEYPFFES
RVDNKERTVISNLRPFTLYRIDIHSCNHEAEKLGCSASNFVFARTMPAEGADDIPGPVTW
EPRPENSIFLKWPEPENPNGLILMYEIKYGSQVEDQRECVSRQEYRKYGGAKLNRLNPGN
YTARIQATSLSGNGSWTDPVFFYVQAKTGYENFIHLIIALPVAVLLIVGGLVIMLYVFHR
KRNNSRLGNGVLYASVNPEYFSAADVYVPDEWEVAREKITMSRELGQGSFGMVYEGVAKG
VVKDEPETRVAIKTVNEAASMRERIEFLNEASVMKEFNCHHVVRLLGVVSQGQPTLVIME
LMTRGDLKSYLRSLRPEMENNPVLAPPSLSKMIQMAGEIADGMAYLNANKFVHRDLAARN
CMVAEDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTYSDVWSFGV
VLWEIATLAEQPYQGLSNEQVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPSFL
EIISSIKDEMEPGFREVSFYYSEENKLPEPEELDLEPENMESVPLDPSASSSSLPLPDRH
SGHKAENGPGPGVLVLRASFDERQPYAHMNGGRKNERALPLPQSSTC
NT seq 4104 nt   +upstreamnt  +downstreamnt
atgaagtctggctctggagaagggtccccgacctcgctgtgggggctcctgtttctctcc
gccgcgctctcgctctggccgacgagtggagaaatctgtgggccgggcatcgacatccgc
aacgactatcagcagctgaagcgcctggagaactgcacggtgatcgagggctacctccac
atcctgctcatctccaaggccgaggactaccgcagctaccgcttccccaagctcacggtc
atcaccgagtacttgctgttgttccgagtggctggcctagagagcctcggagacctgttc
cccaacctcacggtaatccgcggctggaaactcttctacaactacgccctggtcatcttt
gagatgaccaatctcaaggatattgggctttacaacctgaggaacattactcggggggcc
atcaggattgagaaaaatgctgacctctgttacctctccactgtggactggtccctgatc
ctggatgcagtgtccaataactacattgtggggaataagcccccaaaggaatgcggggac
ctgtgtccggggaccatggaggagaagccgatgtgcgagaagaccaccatcaacaatgag
tacaactaccgctgctggaccacaaaccgctgccagaaaatgtgcccgagtgcctgtggg
aagagggcatgcaccgagaacaacgagtgctgccaccccgagtgcctgggcagctgcagc
gcgcctgacaacgacacggcctgtgtagcttgccgccactactactacgccggtgtctgc
gtgcctgcctgcccgcccaacacctacaggtttgagggctggcgctgtgtggaccgtgac
ttctgcgccaacatcctcagtgccgagagcagcgactccgagggtttcgtgatccacgac
ggcgagtgcatgcaggagtgcccctcaggcttcatccgcaacggcagccagagcatgtac
tgcatcccttgtgaaggtccttgccccaaggtctgtgaggaagaaaagaaaacaaagacc
attgattctgttacttctgctcagatgcttcaaggatgcaccatcttcaagggcaatttg
ctcattaacatccgacgggggaataacattgcttcagaactggagaacttcatggggctc
atcgaggtggtgacgggctacgtgaagatccgccattcccatgccttggtctccttgtcc
ttcctaaaaaaccttcgcctcatcttaggagaggagcagctagaagggaattactccttc
tacgtcctcgacaaccagaacttgcagcaactatgggactgggaccaccgcaacctgacc
atcaaagcagggaaaatgtactttgctttcaatcccaaattgtgtgtttcggaaatttac
cgcatggaggaagtgacggggactaaagggcgccaaagcaaaggggacataaacaccagg
aacaacggggaaagagcctcctgtgaaagtgacgtcctgcatttcacctccaccaccacg
tggaagaatcgcatcatcataacctggcaccggtaccggccccctgactacagggatctc
atcagcttcaccgtttactacaaggaagcaccttttaagaatgtcacggagtatgatggg
caggatgcctgcggctccaacagctggaacatggtggacgtggacctcccgcccaacaag
gacgtggagcccggcatcttactgcatgggctgaagccctggactcagtacgccgtttac
gtcaaggctgtgaccctcaccatggtggagaacgaccatatccgtggggccaagagtgag
atcttgtacattcgcaccaatgcttcagttccttccattcccttggacgttctttcagca
tcgaactcctcttctcagttaatcgtgaagtggaaccctccctctctgcccaacggcaac
ctgagttactacattgtgcgctggcagcggcagcctcaggacggctacctttaccggcac
aattactgctccaaagacaaaatccccatcaggaagtatgccgacggcaccattgacatt
gaggaggtcacagagaacccgaagactgaggtgtgtggtggagagaaagggccttgctgc
gcctgccccaaaactgaagctgagaagcaggccgagaaggaggaggctgagtaccgcaaa
gtctttgagaatttcctgcacaactccatctttgtgcccagacctgaaaggaagcggaga
gatgtcatgcaagtggccaacaccaccatgtccagccgaagcaggaacaccacggtggca
gacacctacaacatcacagatctggaagagctagagacagagtaccctttctttgagagc
agagtggataataaggagagaactgtcatttctaaccttcggcctttcacattgtaccgc
attgatatccacagctgcaaccacgaggctgagaaactgggctgcagcgcctccaacttt
gtctttgcaaggactatgcctgcagaaggagcagatgacattcctgggccagtgacctgg
gagccaaggcctgaaaactccatctttttaaagtggccagaacctgagaatcccaatgga
ttgattctaatgtatgaaataaaatacggatcacaagttgaggatcagcgagaatgtgtg
tccagacaggaatacaggaagtatggaggggccaagctaaaccggctaaacccggggaac
tacacagcccggattcaggctacatctctctctgggaatgggtcgtggacagatcctgtg
ttcttctatgtccaggccaaaacaggatacgaaaacttcatccatctgatcatcgctctg
cccgtcgctgtcctgttgatcgtgggagggttggtgatcatgctgtacgtcttccataga
aagagaaataacagcaggctggggaatggagtgctgtacgcgtctgtgaacccggagtac
ttcagcgctgcggatgtgtacgttcctgatgagtgggaggtggctcgggagaagatcacc
atgagccgggaacttgggcaggggtcgtttgggatggtctatgaaggagttgccaagggt
gtggtgaaagacgaacctgaaaccagagtggccattaaaacagtgaacgaggccgcgagc
atgcgtgaaaggatcgagtttctcaacgaggcttctgtgatgaaggagttcaattgtcac
catgtggtgcggttgctgggtgtggtgtcccagggccagccaacgctggtcatcatggaa
ctgatgacgcggggcgatctcaaaagttatctccggtctctgaggccagaaatggagaat
aatccagtcctagcacctccaagcctaagcaagatgattcagatggctggagagattgca
gacggcatggcatacctcaacgccaacaagttcgtccacagagaccttgctgcccggaat
tgcatggtagccgaggatttcacagtcaaaattggagattttgggatgacgcgagatatc
tatgagacagactattaccggaaaggagggaaagggctgttgcccgtgcgctggatgtct
cccgagtccctcaaggatggagtcttcaccacttactcggacgtctggtccttcggggtt
gtcctctgggagatcgccacactggccgagcagccctaccagggcttgtccaacgagcaa
gtccttcgcttcgtcatggagggcggccttctggacaagccagacaactgccccgacatg
ctgtttgaattgatgcgcatgtgctggcagtacaaccccaagatgaggccttccttcctg
gagatcatcagcagcatcaaagacgagatggagcctggcttccgggaggtctccttctac
tacagtgaggagaacaagctgcccgagccggaggagctggacctggagccagagaacatg
gagagcgtccccctggacccctcggcctcctcgtcctccctgccactgcccgacagacac
tcaggacacaaggccgagaacggccccggccctggagtgctggtgctccgcgccagcttc
gatgagagacagccttacgcacacatgaacggtggccgcaagaacgagcgggccttgccg
ctgccccagtcttcgacctgctga

DBGET integrated database retrieval system