KEGG   Macaca mulatta (rhesus monkey): 708316
Entry
708316            CDS       T01028                                 

Gene name
HGF
Definition
(RefSeq) hepatocyte growth factor isoform X3
  KO
K05460  hepatocyte growth factor
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc01521  EGFR tyrosine kinase inhibitor resistance
mcc04010  MAPK signaling pathway
mcc04014  Ras signaling pathway
mcc04015  Rap1 signaling pathway
mcc04020  Calcium signaling pathway
mcc04151  PI3K-Akt signaling pathway
mcc04510  Focal adhesion
mcc05144  Malaria
mcc05200  Pathways in cancer
mcc05205  Proteoglycans in cancer
mcc05211  Renal cell carcinoma
mcc05218  Melanoma
mcc05223  Non-small cell lung cancer
mcc05225  Hepatocellular carcinoma
mcc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    708316 (HGF)
   04014 Ras signaling pathway
    708316 (HGF)
   04015 Rap1 signaling pathway
    708316 (HGF)
   04020 Calcium signaling pathway
    708316 (HGF)
   04151 PI3K-Akt signaling pathway
    708316 (HGF)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    708316 (HGF)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    708316 (HGF)
   05205 Proteoglycans in cancer
    708316 (HGF)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    708316 (HGF)
   05226 Gastric cancer
    708316 (HGF)
   05218 Melanoma
    708316 (HGF)
   05211 Renal cell carcinoma
    708316 (HGF)
   05223 Non-small cell lung cancer
    708316 (HGF)
  09174 Infectious disease: parasitic
   05144 Malaria
    708316 (HGF)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    708316 (HGF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcc04052]
    708316 (HGF)
   00536 Glycosaminoglycan binding proteins [BR:mcc00536]
    708316 (HGF)
Cytokines and growth factors [BR:mcc04052]
 Growth factors
  Growth factors (RTK binding)
   708316 (HGF)
Glycosaminoglycan binding proteins [BR:mcc00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   708316 (HGF)
SSDB
Motif
Pfam: Kringle Trypsin PAN_1 DUF1986
Other DBs
NCBI-GeneID: 708316
NCBI-ProteinID: XP_014989672
Ensembl: ENSMMUG00000018652
UniProt: F7A5G3
LinkDB
Position
3
AA seq 728 aa
MWVTKLLPALLLQHVLLHLLLLPIAIPYAEGHKKRRNTIHEFKKSAKTTLIKIDPALKIK
TKKVNTADQCANRCTRNNGLPFTCKAFVFDKARKQCLWFPFNSMSSGVKKEFGHEFDLYE
NKDYIRNCIIGKGRSYKGTVSITKSGIKCQPWSSMIPHEHSFLPSSYRGKDLQENYCRNP
RGEEGGPWCFTSNPEVRYEVCDIPQCSEVECMTCNGESYRGLMDHTESGKICQRWDHQTP
HRHKFLPERYPDKGFDDNYCRNPDGQPRPWCYTLDPHTRWEYCAIKTCADNTVNDTDVPM
ETTECIQGQGEGYRGTANTIWNGIPCQRWDSQYPHKHDMTPENFKCKDLRENYCRNPDGS
ESPWCFTTDPNIRVGYCSQIPNCDMSNGQDCYRGNGKNYMGNLSQTRSGLTCSMWNKNME
DLHRHIFWEPDASKLNENYCRNPDDDAHGPWCYTGNPLIPWDYCPISRCEGDTTPTIVNL
DHPVISCAKTKQLRVVNGIPTRTNVGWMISLRYRNKHICGGSLIKESWVLTARQCFPSRD
LKDYEAWLGIHDVHGRGEEKRKQVLNVSQLVYGPEGSDLVLMKLARPAVLDDFVNTIDLP
NYGCTIPEKTSCSVYGWGYTGLINYDGLLRVAHLYIMGNEKCSQHHRGKVTLNESEICAG
AEKIGSGPCEGDYGGPLVCEQHKMRMVLGVIVPGRGCAIPNRPGIFVRVAYYAKWIHKII
LTYKVPQS
NT seq 2187 nt   +upstreamnt  +downstreamnt
atgtgggtgaccaaactcctgccagccctgctgctgcagcatgtcctcctgcatctcctc
ctgctccccatcgccatcccctatgcagagggacataagaaaagaagaaatacaattcac
gaattcaaaaaatcagcaaagactaccctaatcaaaatagatccagcactgaagataaaa
accaaaaaagtgaatactgcagaccaatgtgctaatagatgtactaggaataatggactt
ccattcacttgcaaggcctttgtttttgataaagcgagaaaacaatgcctctggttcccc
ttcaatagcatgtcaagtggagtgaagaaagaatttggccatgaatttgacctctatgaa
aacaaagactacattagaaactgcatcatcggtaaaggacgcagctacaagggaacagta
tctatcactaagagtggcatcaaatgtcagccctggagttccatgataccacacgaacac
agctttttgccttcgagctatcggggtaaagacctacaggaaaactactgtcgaaatcct
cgaggggaagaagggggaccctggtgtttcacaagcaatccagaggtacgctacgaagtc
tgtgacattcctcagtgttcagaagttgaatgcatgacctgcaatggggagagttatcga
ggtctcatggatcatacagaatcaggcaagatttgtcagcgctgggatcatcagacacca
caccggcacaaattcttgcctgaaagatatcctgacaagggctttgatgataattattgc
cgcaatcccgatggccagccgaggccatggtgctatactcttgaccctcacacccgctgg
gagtactgtgcaattaaaacatgcgctgacaatactgtaaatgatactgatgttcctatg
gaaacaactgaatgcatccaaggtcaaggagaaggctacaggggcactgccaataccatt
tggaatggaattccatgtcagcgttgggattctcagtatcctcacaagcatgacatgact
cctgaaaatttcaagtgcaaggacctacgagaaaattactgccgaaatccagatgggtct
gaatcaccctggtgttttaccactgatccaaacatccgagttggttactgctcccaaatt
ccaaactgtgatatgtcaaatggacaagattgttatcgtgggaatggcaaaaattatatg
ggcaacttatcccaaacaagatctggactaacgtgttcaatgtggaacaagaacatggaa
gacttacaccgtcatatcttctgggaaccagatgcaagtaagctgaatgagaattactgc
cgaaatccagatgatgatgctcatggaccctggtgctacacgggaaatccactcattcct
tgggattattgccctatttctcgttgtgaaggtgataccacacctacaatagtcaattta
gaccatcctgtaatatcttgcgccaaaacgaaacaactgcgagttgtaaatgggattcca
acacgaacaaatgtaggatggatgattagtttgagatacagaaataaacatatctgcgga
ggatcattgataaaggaaagttgggttcttactgcacgacagtgtttcccttctcgagac
ttgaaagattatgaggcttggcttggaattcatgatgtccatggaagaggagaggagaaa
cgcaaacaggttctcaatgtttcccagctggtatatggccctgaaggatcagatctggtt
ttaatgaagcttgccagacctgctgtcctggatgattttgttaatacaattgatttacct
aattatggatgcacaattcctgaaaagaccagttgcagtgtttatggctggggctacact
ggattgatcaactatgacggtctattacgagtggcacatctctatataatgggaaatgag
aaatgcagccagcatcaccgagggaaggtgactctgaatgagtctgaaatatgtgctggg
gctgagaagattggatcaggaccatgtgagggggattatggtggcccacttgtttgtgag
caacataaaatgagaatggttcttggtgtcattgttcccggccgtggatgcgccattcca
aatcgtcctggtatttttgtccgagtagcatattatgcaaaatggatacacaaaattatt
ttaacatataaggtaccacagtcatag

DBGET integrated database retrieval system