KEGG   Macaca mulatta (rhesus monkey): 708391Help
Entry
708391            CDS       T01028                                 

Gene name
TRAF2
Definition
(RefSeq) TNF receptor-associated factor 2
  KO
K03173  TNF receptor-associated factor 2 [EC:2.3.2.27]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04010  MAPK signaling pathway
mcc04064  NF-kappa B signaling pathway
mcc04071  Sphingolipid signaling pathway
mcc04141  Protein processing in endoplasmic reticulum
mcc04210  Apoptosis
mcc04217  Necroptosis
mcc04380  Osteoclast differentiation
mcc04621  NOD-like receptor signaling pathway
mcc04622  RIG-I-like receptor signaling pathway
mcc04657  IL-17 signaling pathway
mcc04668  TNF signaling pathway
mcc04920  Adipocytokine signaling pathway
mcc04932  Non-alcoholic fatty liver disease (NAFLD)
mcc05135  Yersinia infection
mcc05160  Hepatitis C
mcc05163  Human cytomegalovirus infection
mcc05167  Kaposi sarcoma-associated herpesvirus infection
mcc05168  Herpes simplex virus 1 infection
mcc05169  Epstein-Barr virus infection
mcc05170  Human immunodeficiency virus 1 infection
mcc05200  Pathways in cancer
mcc05203  Viral carcinogenesis
mcc05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    708391 (TRAF2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    708391 (TRAF2)
   04064 NF-kappa B signaling pathway
    708391 (TRAF2)
   04668 TNF signaling pathway
    708391 (TRAF2)
   04071 Sphingolipid signaling pathway
    708391 (TRAF2)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    708391 (TRAF2)
   04217 Necroptosis
    708391 (TRAF2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    708391 (TRAF2)
   04622 RIG-I-like receptor signaling pathway
    708391 (TRAF2)
   04657 IL-17 signaling pathway
    708391 (TRAF2)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    708391 (TRAF2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    708391 (TRAF2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    708391 (TRAF2)
   05203 Viral carcinogenesis
    708391 (TRAF2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    708391 (TRAF2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    708391 (TRAF2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    708391 (TRAF2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    708391 (TRAF2)
   05160 Hepatitis C
    708391 (TRAF2)
   05168 Herpes simplex virus 1 infection
    708391 (TRAF2)
   05163 Human cytomegalovirus infection
    708391 (TRAF2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    708391 (TRAF2)
   05169 Epstein-Barr virus infection
    708391 (TRAF2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mcc03019]
    708391 (TRAF2)
   04121 Ubiquitin system [BR:mcc04121]
    708391 (TRAF2)
Enzymes [BR:mcc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     708391 (TRAF2)
Messenger RNA biogenesis [BR:mcc03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     708391 (TRAF2)
Ubiquitin system [BR:mcc04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRAF proteins
    708391 (TRAF2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TRAF_BIRC3_bd zf-TRAF MATH SlyX DUF1664
Motif
Other DBs
NCBI-GeneID: 708391
NCBI-ProteinID: NP_001181721
Ensembl: ENSMMUG00000011527
LinkDB All DBs
Position
15
AA seq 490 aa AA seqDB search
MAAASVTPPGSLELLQPGFSKTLLGTKLEAKYLCSACGNVLRRPFQAQCGHRSGPQNCAA
CVHEGIYEEGISILESSSAFPDNAARREVESLPAVCPIDGCTWKGTLKEYESCHEGRCPL
MLTECPACKGLVRLGEKERHLEHECPERSLSCRHCRAPCCGADGKAHHEVCPKFPLTCDG
CGKKKIPREKFQDHVKTCGKCRIPCRFHAIGCLETVEGEKQQEHEAQWLREHLAMLLSSV
LEAKPLLGDQSHAGSELLQRCENLEKKTATFENIVCVLNREVERVAMTAEACSRQHRLDQ
DKIEALSNKVQQLERSIGLKDLAMADLEQKVLEMEASTYDGVFIWKISDFARKRQEAVAG
RTPAIFSPAFYTSRYGYKMCLRIYLNGDGTGRGTHLSLFFVVMKGPNDALLRWPFNQKVT
LMLLDQNNREHVIDAFRPDVTSSSFQRPVNDMNIASGCPLFCPVSKMEAKNSYVRDDAIF
IKAIVDLTGL
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atggctgcagctagcgtgaccccccctggctccttggagttgctacagcctggcttctcc
aagaccctcctggggaccaagctggaagccaagtacctgtgctccgcctgcggaaacgtc
ctgcgcaggcccttccaggcgcagtgtggccaccgctctgggcctcagaactgtgctgcc
tgtgttcacgagggcatatatgaagaaggcatttctattttagaaagcagttcggctttc
ccagataatgctgcccgcagggaggtggagagcctgccggccgtctgtcccattgatggg
tgcacctggaaggggaccctgaaagaatatgagagctgccacgaaggccgctgcccgctc
atgctgaccgaatgtcctgcatgcaaaggcctggtccgcctgggtgaaaaggagcgccac
ctggagcacgagtgcccagagagaagcctgagctgccggcattgccgggcgccctgctgc
ggggcagacgggaaggcgcaccacgaggtctgccccaagttccccttgacttgtgatggc
tgcggcaagaaaaagatcccccgggagaagtttcaggaccacgtcaagacttgtggcaag
tgtcgaatcccttgcagattccacgccatcggctgcctcgagacggtggagggtgagaaa
cagcaagagcacgaggcacagtggctgcgggagcacctggccatgctcctgagctcggtg
ctggaggcaaagcctctcttgggagaccagagccacgcggggtcagagctcctgcagagg
tgcgagaacctggagaagaagacggccacttttgagaacattgtctgcgtcctgaaccgg
gaggtggagagggtggccatgactgccgaggcctgcagccggcagcaccggctggaccaa
gacaagattgaagccctgagtaacaaggtgcagcagctggagaggagcattggcctcaag
gacctggcgatggctgacctggagcagaaggtcttggagatggaggcatccacctacgat
ggggtcttcatctggaagatctcagacttcgccaggaagcgccaggaagctgtggccggc
cgcacacccgccatcttctccccagccttctacaccagcaggtacggctacaagatgtgt
ctgcgtatctacctgaacggcgacggcaccgggcgaggaacgcacctgtccctcttcttt
gtggtgatgaagggcccgaatgacgccctgctgcggtggcccttcaaccagaaggtgacc
ttaatgctgctcgaccagaataaccgggagcacgtgattgatgccttcaggcccgacgtg
acctcgtcctcttttcagaggccagtcaatgacatgaacatcgcaagtggctgccccctc
ttctgccccgtctccaagatggaggccaagaattcctacgtgcgggacgatgccatcttc
atcaaggccattgtggacctgacagggctctaa

DBGET integrated database retrieval system