KEGG   Macaca mulatta (rhesus monkey): 708441Help
Entry
708441            CDS       T01028                                 

Gene name
HDAC1
Definition
(RefSeq) histone deacetylase 1
  KO
K06067  histone deacetylase 1/2 [EC:3.5.1.98]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04110  Cell cycle
mcc04213  Longevity regulating pathway - multiple species
mcc04330  Notch signaling pathway
mcc04919  Thyroid hormone signaling pathway
mcc05016  Huntington's disease
mcc05034  Alcoholism
mcc05165  Human papillomavirus infection
mcc05169  Epstein-Barr virus infection
mcc05200  Pathways in cancer
mcc05202  Transcriptional misregulation in cancer
mcc05203  Viral carcinogenesis
mcc05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    708441 (HDAC1)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    708441 (HDAC1)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    708441 (HDAC1)
  Aging
   04213 Longevity regulating pathway - multiple species
    708441 (HDAC1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    708441 (HDAC1)
   05202 Transcriptional misregulation in cancers
    708441 (HDAC1)
   05203 Viral carcinogenesis
    708441 (HDAC1)
   05220 Chronic myeloid leukemia
    708441 (HDAC1)
  Neurodegenerative diseases
   05016 Huntington's disease
    708441 (HDAC1)
  Substance dependence
   05034 Alcoholism
    708441 (HDAC1)
  Infectious diseases
   05169 Epstein-Barr virus infection
    708441 (HDAC1)
   05165 Human papillomavirus infection
    708441 (HDAC1)
Enzymes [BR:mcc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     708441 (HDAC1)
Chromosome and associated proteins [BR:mcc03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     708441 (HDAC1)
   HDAC complexes
    Sin3A-HDAC complex
     708441 (HDAC1)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    708441 (HDAC1)
  Chromatin remodeling factors
   NuRD complex
    708441 (HDAC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 708441
NCBI-ProteinID: XP_014989621
Ensembl: ENSMMUG00000009948
UniProt: H9Z897
LinkDB All DBs
Position
1
AA seq 482 aa AA seqDB search
MAQTQGTRRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKAN
AEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAS
AVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHG
DGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAI
FKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGG
GGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLE
KIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESGDEDEEDPDKRISICSSDKRIACEEEF
SDSEEEGEGGRKNSSNFKKAKRVKTEDEKEKDPEEKKEVTEEEKTKEEKPEAKGVKEEVK
LA
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagacgcagggcacccggaggaaagtctgttactactacgacggggatgttgga
aattactactacggacaaggccacccaatgaagcctcaccgaatccgcatgactcataat
ttgctgctcaactatggtctctaccgaaaaatggaaatctatcgccctcacaaagccaat
gctgaggagatgaccaagtaccatagtgacgactacattaaattcttgcgctccatccgt
ccagataacatgtcggagtacagcaagcagatgcagagattcaacgttggtgaggactgt
ccagtattcgacggcctctttgagttctgtcagttgtctactggtggttctgtggcaagt
gctgtgaaacttaataagcagcagacggacatcgctgtgaattgggctgggggcctgcac
catgcaaagaagtctgaggcatctggcttctgttacgtcaatgatatcgtcttggccatc
ctggaactgctaaagtatcaccagagggtgctgtatattgacattgatattcaccatggc
gacggcgtggaagaggccttctataccacagaccgggtcatgactgtgtcctttcataag
tatggagagtacttcccaggaactggggacctgcgggatatcggggctggaaaaggcaag
tattatgctgttaactacccgctccgagacgggattgatgacgagtcctatgaggccatt
ttcaagccggtcatgtccaaagtaatggagatgttccaacctagcgcggtggtcttacag
tgtggctcagactccctgtctggggatcggttaggttgcttcaatctaaccatcaaaggg
cacgccaagtgtgtggaatttgtcaagagctttaacctgcctatgctgatgctgggaggt
ggtggttacaccattcgtaatgttgcccggtgctggacatacgagacagctgtggccctg
gatacggagatccctaatgagcttccatacaacgactactttgaatactttggaccggat
ttcaagctccacatcagtccttccaatatgactaaccagaacacgaatgagtacctggag
aagatcaaacagcggctgtttgagaaccttagaatgctgccgcatgcacctggggtccaa
atgcaggcgattcctgaggacgccatccctgaggagagtggcgatgaggacgaagaagac
cctgacaagcgcatctcgatctgctcctccgacaaacgaattgcctgtgaggaagagttc
tccgattctgaagaggagggagaggggggccgcaagaactcttccaacttcaaaaaagcc
aagagagtcaaaacagaggatgaaaaagagaaagacccagaggagaagaaagaagtcaca
gaagaggagaaaaccaaggaggaaaagccagaagccaaaggggtcaaggaggaggtcaag
ttggcctga

DBGET integrated database retrieval system