KEGG   Macaca mulatta (rhesus monkey): 708606
Entry
708606            CDS       T01028                                 

Gene name
FADD
Definition
(RefSeq) FAS-associated death domain protein
  KO
K02373  FAS-associated death domain protein
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc01524  Platinum drug resistance
mcc04210  Apoptosis
mcc04215  Apoptosis - multiple species
mcc04217  Necroptosis
mcc04620  Toll-like receptor signaling pathway
mcc04621  NOD-like receptor signaling pathway
mcc04622  RIG-I-like receptor signaling pathway
mcc04657  IL-17 signaling pathway
mcc04668  TNF signaling pathway
mcc05010  Alzheimer disease
mcc05022  Pathways of neurodegeneration - multiple diseases
mcc05132  Salmonella infection
mcc05142  Chagas disease
mcc05152  Tuberculosis
mcc05160  Hepatitis C
mcc05161  Hepatitis B
mcc05162  Measles
mcc05163  Human cytomegalovirus infection
mcc05164  Influenza A
mcc05165  Human papillomavirus infection
mcc05167  Kaposi sarcoma-associated herpesvirus infection
mcc05168  Herpes simplex virus 1 infection
mcc05169  Epstein-Barr virus infection
mcc05170  Human immunodeficiency virus 1 infection
mcc05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    708606 (FADD)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    708606 (FADD)
   04215 Apoptosis - multiple species
    708606 (FADD)
   04217 Necroptosis
    708606 (FADD)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    708606 (FADD)
   04621 NOD-like receptor signaling pathway
    708606 (FADD)
   04622 RIG-I-like receptor signaling pathway
    708606 (FADD)
   04657 IL-17 signaling pathway
    708606 (FADD)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    708606 (FADD)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    708606 (FADD)
   05022 Pathways of neurodegeneration - multiple diseases
    708606 (FADD)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    708606 (FADD)
   05152 Tuberculosis
    708606 (FADD)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    708606 (FADD)
   05161 Hepatitis B
    708606 (FADD)
   05160 Hepatitis C
    708606 (FADD)
   05164 Influenza A
    708606 (FADD)
   05162 Measles
    708606 (FADD)
   05168 Herpes simplex virus 1 infection
    708606 (FADD)
   05163 Human cytomegalovirus infection
    708606 (FADD)
   05167 Kaposi sarcoma-associated herpesvirus infection
    708606 (FADD)
   05169 Epstein-Barr virus infection
    708606 (FADD)
   05165 Human papillomavirus infection
    708606 (FADD)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    708606 (FADD)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    708606 (FADD)
SSDB
Motif
Pfam: DED Death tRNA_NucTran2_2
Other DBs
NCBI-GeneID: 708606
NCBI-ProteinID: XP_001100468
LinkDB
Position
14
AA seq 277 aa
MRGSRSFREITVQKAPWSTSGRGSGTEVHGRGRNFGLLGKRRYVARARQPKTAGAPPARP
QSRPPAGPAMDPFLVLLHSVSSSLSSSELTELKFLCLGRVSKRKLERVQSGLDLFSVLLE
QNDLEPGHTDLLRELLVSLRRHDLLRRLDDFEAGVAAGAAPGEEDLCAAFNVICDNVGKD
WRRLARQLKVSDAKIDSIEDRYPRNLTERVRESLRTWKNAEKENATVACLVAALRACQMN
LVADLVQEVQQARDLQNRSGAMSPMSWNSDASTSEAS
NT seq 834 nt   +upstreamnt  +downstreamnt
atgcgcggttcccggagttttcgcgagataacagtccaaaaggcgccttggtcgacttcc
ggtaggggatccggcaccgaagtgcacggccgagggcggaactttgggctgctgggcaag
cggcgatacgtggccagggccagacagccgaagacagcgggcgcgccaccggccaggcca
cagtcccggccgcctgcaggccctgccatggacccgttcctggtgctgctgcactcggtg
tcgtccagcctgtcgagcagcgagctgaccgagctcaagttcctatgcctcgggcgcgtg
agcaagcgcaagctggagcgcgtgcagagcggcctggacctcttctccgtactgctggag
cagaacgacctggagcccgggcacaccgacctcctgcgcgagctgctcgtctccctgcgg
cgccacgacctgctgcggcgcctcgacgacttcgaggcgggggtggcggccggggccgcg
cctggggaagaagacctgtgtgcagcatttaacgtcatatgtgataatgtggggaaagac
tggagaaggctggctcgtcagctcaaagtctcagacgccaagatcgacagcatcgaggac
agatacccccgcaacctgacagagcgcgtgcgggagtcactgagaacctggaagaacgca
gagaaggagaacgccacggtggcctgcctggtggcggctctcagggcctgccagatgaac
ctggtggccgacctggtacaagaggtgcagcaggcccgggacctccagaacaggagtggg
gccatgtccccgatgtcatggaactcggacgcatccacctccgaagcatcctga

DBGET integrated database retrieval system