KEGG   Macaca mulatta (rhesus monkey): 708999
Entry
708999            CDS       T01028                                 

Gene name
SIKE1
Definition
(RefSeq) suppressor of IKBKE 1
  KO
K12656  suppressor of IKK-epsilon
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04622  RIG-I-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    708999 (SIKE1)
SSDB
Motif
Pfam: SIKE Herpes_BLRF2 DUF4250 TSC22 OmpH YabA
Other DBs
NCBI-GeneID: 708999
NCBI-ProteinID: NP_001248423
Ensembl: ENSMMUG00000001973
UniProt: H9G023
LinkDB
Position
1
AA seq 207 aa
MSCTIEKILTDAKTLLERLREHDAAAESLVDQSAALHRRVAAMREAGTALPDQYQEDASD
MKDMSKYKPHILLSQENTQIRDLQQENRELWISLEEHQDALELIMSKYRKQMLQLMVAKK
AVDAEPVLKAHQSHSAEIESQIDRICEMGEVMRRAVQVDDDQFCKIQEKLAQLELENKEL
RELLSISSESLQARKENSMDTASQAIK
NT seq 624 nt   +upstreamnt  +downstreamnt
atgagctgcaccatcgagaagatcctgacagacgccaagacgcttctggagaggctgcgg
gagcacgatgcggctgccgagtcgctggtggatcagtcggcagcgctgcaccggcgggta
gccgctatgcgggaggcggggacagcgcttccggaccagtatcaagaggatgcatccgat
atgaaggacatgtccaaatacaaacctcacattctgctgtctcaagagaacacacagatt
agagacttgcaacaggaaaacagagagctgtggatttccttggaggaacaccaggatgct
ttggagctcatcatgagcaagtaccggaaacagatgttacagttaatggttgctaaaaaa
gctgtggatgccgaaccagtcctgaaagctcaccagtctcactctgcagaaattgagagt
cagattgacagaatctgcgaaatgggagaagtgatgaggagagcagttcaggtggatgat
gaccagttttgtaagattcaggaaaaattagcccaattagagcttgaaaataaggaactt
cgagaattattgtccattagcagtgagtctcttcaagccagaaaggaaaactcaatggac
actgcttcccaagccatcaaataa

DBGET integrated database retrieval system