KEGG   Macaca mulatta (rhesus monkey): 709116
Entry
709116            CDS       T01028                                 

Gene name
DHX58
Definition
(RefSeq) probable ATP-dependent RNA helicase DHX58
  KO
K12649  ATP-dependent RNA helicase DHX58 [EC:3.6.4.13]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04622  RIG-I-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    709116 (DHX58)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:mcc04054]
    709116 (DHX58)
Enzymes [BR:mcc01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     709116 (DHX58)
Pattern recognition receptors [BR:mcc04054]
 Cytoplasmic pattern recognition receptors
  RIG-I-like receptors
   709116 (DHX58)
SSDB
Motif
Pfam: RIG-I_C-RD RIG-I_C Helicase_C ResIII DEAD SWI2_SNF2 AAA_19
Other DBs
NCBI-GeneID: 709116
NCBI-ProteinID: XP_001108799
Ensembl: ENSMMUG00000014755
UniProt: G7NIK3
LinkDB
Position
16
AA seq 678 aa
MELRPYQWEVIMPALEGKNIIIWLPTGAGKTRAAAYVAKRHLETVDGAKVVVLVNRVHLV
TQHGEEFRRILDGRWTVTTLSGDMGPRAGFGHLARCHDLLICTAELLQMALTSPEEEEHV
ELTAFSLIVVDECHHTHKDTVYNVIMSRYLELKLQRARPLPQVLGLTASPGTGGASKLDG
AIDHVLQLCANLDTWCIMSPQNYRPRLQEHSQQPCKQYNLCHRRSQDPFGDLLKKLMDQV
HDHLEMPELSRNFGTQMYEQQVVKLSEAAALAGLQEQRVYALHLRRYNDALLIHDTVRAV
DALAALQDFYHREHVTKTQILCAERRLLALFDGHKNVLAHLATHGPENPKLEMLEKILQR
QFRSSDSPRGIIFTRTRQSAHSLLLWLQQQPGLQTVDIRAQLLIGAGNSSQSTHMTQRDQ
QEVIRKFRDGTLNLLVATSVAEEGLDIPQCNVVVRYGLLTNEISMVQARGRARADQSVYS
FVATEGSRELKRELINEALEMLMEQAVAAVQKMDQAEYQAKIQDLQQAALTKRAAQAAQR
ESQRRQFPVEHVQLLCINCMVAVGHGSDLRKVEGTHHVNVNPNFSIYYNVSRDPVVINKV
FKDWKPGGVISCRNCGEIWGLQMIYKSVKLPALKVRSMLLETPQGRIQAKKWSRVPFSVP
DFDFLQHCAQNLSDLSLD
NT seq 2037 nt   +upstreamnt  +downstreamnt
atggagctgcggccctaccagtgggaggtgatcatgcctgccctggagggcaaaaatatc
atcatctggctgcccacgggggctgggaagacccgggcggctgcttatgtggccaagcgg
cacctagagactgtggatggagccaaggtggttgtattggtcaacagggtgcacctggtg
acccagcacggtgaagagttcaggcgcatactggatggacgctggaccgtgacaacactg
agtggggacatggggccacgtgctggctttggccacctggcccggtgccatgacctgctc
atctgcacagcagagcttctgcagatggcactgaccagccccgaggaggaggagcacgtg
gagctcactgccttctccctgatcgtggtggatgagtgccaccacacgcacaaggacact
gtctacaacgtcatcatgagccggtacctagaacttaaactccagagggcacggccccta
ccccaggtgctgggtctcacagcctccccaggcactggcggggcctccaagctcgatggg
gccatcgaccacgtcctgcagctctgtgccaacttggacacgtggtgcatcatgtcaccc
cagaactatcgcccccggctgcaggagcacagccaacagccttgcaaacagtacaacctc
tgccacaggcgcagccaggatccgtttggggacttgctgaagaagctcatggaccaagtc
cacgaccacctggagatgcctgagttgagccggaactttgggacgcagatgtatgagcag
caggtggtgaagctgagcgaggctgcggctttggccgggctccaggagcagcgggtgtac
gcacttcacctgaggcgctacaatgacgcgctgctcatccatgacaccgtccgcgccgtg
gatgccctggctgcgctgcaggatttctatcacagggagcacgtcactaaaacccagatc
ctgtgtgccgagcgccggctgctggccctgttcgatggccataagaatgtgctggcccac
ctggcaactcatggcccagagaatccaaaactggagatgctggaaaagatcctgcaaagg
cagttcaggagctctgacagcccccggggtatcatcttcacccgcacccgccagagcgca
cactccctcctgctctggcttcagcagcagccgggcctgcagactgtggacattcgggcc
cagctactgattggggctgggaacagcagccagagcacccacatgacccagagggaccag
caagaagtaatccggaagttccgagatggaaccctgaaccttctggtggccacgagcgtg
gcagaggaggggctggacatcccacagtgcaacgtggtggtgcgctatgggctcctgacc
aatgaaatctccatggtccaggccaggggccgtgcccgggccgatcagagtgtgtactcg
tttgtagcaactgagggtagccgggagctgaagcgggagctgatcaatgaggcgctggag
atgctgatggagcaggcagtggctgctgtgcagaagatggaccaggccgagtaccaggcc
aagatccaggatctgcagcaggcagccctgaccaagcgggcggcccaggcagcccagcgg
gagagccagaggcggcagttcccagtggagcacgtgcagctactctgcatcaactgcatg
gtggctgtgggccatggcagcgacctacggaaggtggagggcacccatcatgtcaacgtg
aaccccaacttctcgatctactataacgtctccagggatcctgtggtcatcaacaaagtc
ttcaaggactggaaacctgggggtgtcatcagctgcaggaactgtggggagatctgggga
ctgcagatgatctacaagtcagtgaagctgccagcgctgaaagtccgcagcatgctgctg
gagacccctcaagggcggatccaggccaaaaagtggtcccgcgtgcccttctccgtgcct
gactttgacttcctgcagcattgtgcccagaacctttcggacctctccctggactga

DBGET integrated database retrieval system